Conserved Protein Domain Family
BLOC1_2

?
pfam10046: BLOC1_2 
Biogenesis of lysosome-related organelles complex-1 subunit 2
Members of this family of proteins play a role in cellular proliferation, as well as in the biogenesis of specialized organelles of the endosomal-lysosomal system.
Statistics
?
PSSM-Id: 313299
View PSSM: pfam10046
Aligned: 68 rows
Threshold Bit Score: 48.3523
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122018373   49 AAMQQYMTAEMEAYAEDWKLLGKCNEVMESRCQEVRASAKDAVKELETTAGLMEHSLSQLASIDRIEAQLATLTEAVNRI 128
36_pfamImport   3 SSLENLIEADSSAILGDLDLLHKINEAARERYKAMTEAAVGLETDSEYLRGRYAELKKYTKQVDDIDERVGDLEKLVKEL 82
55_pfamImport   5 ASLENLIRLDTESTVGDLDLLVRVNKHAAERYKAMTDAAEGLETDSEHLKAKYAEVQKYVKQVDELDERVTDLEAIVREL 84
25_pfamImport   5 ATLENVIRADTEATVGDLDLLNRVNLHATERYKAIADAAVGLETDSEYLGQKYAEIEKYKQQVDNLDERVGDLEAIVKEL 84
gi 74635349     8 KAAENLIDAQTDYTVTWLDSLEVVNRKQTHKYKQLAESTKGLENDREYLEGLNNENARYVDQLKQVRGHLDTLEKLVGEV 87
57_pfamImport   2 ECMRKILELDTQSTLTNFNVMETLNNSTILRYRELEPYLDSLESETSKIRALDQELAKNKPKLEQLEERTKKLALLVEQM 81
20_pfamImport   4 TQARKLVESDTEVSTIDLNLLGNLNTNQSLNYIKLESQLTSLEKDAEQREALTQELHSLEDELTLIEKSVASLGELVEEL 83
37_pfamImport   3 NAASKIVESDTNVSTIDLNLLENLNTNQSLNYIKLEKNLDDMETNSNQLKQLKAEFESHSQELISIENKIAILEEITTEL 82
44_pfamImport   5 TTLSKVIESDTNISTIDLNLLENLNTNQSLNYIKLENNLNDLEANGKHLKLLKEEFDQHANLLVDIEKKVMRLEEIVNEL 84
gi 74602323    16 NVLSKLVEADTEISTIDLNIIENLNTNQSLNYIKLEQKLNNLEDNANSLEGLNNEFKSFNTTLLEIENQINKIEIITKEL 95
                          90
                  ....*....|..
gi 122018373  129 DEYSKALADRFK 140
36_pfamImport  83 DEWCSELEVKIK 94
55_pfamImport  85 EEWTGELEIKVR 96
25_pfamImport  85 EEWTGELEIKVR 96
gi 74635349    88 DEWSKELEVKVR 99
57_pfamImport  82 DEWSAELEVKS- 92
20_pfamImport  84 DQWSREV----- 90
37_pfamImport  83 DQWSKQLEHNVE 94
44_pfamImport  85 NSWSKELEMDLK 96
gi 74602323    96 DGLSIELSSKVK 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap