Conserved Protein Domain Family
BLOC1_2

?
pfam10046: BLOC1_2 
Biogenesis of lysosome-related organelles complex-1 subunit 2
Members of this family of proteins play a role in cellular proliferation, as well as in the biogenesis of specialized organelles of the endosomal-lysosomal system.
Statistics
?
PSSM-Id: 313299
View PSSM: pfam10046
Aligned: 68 rows
Threshold Bit Score: 48.3523
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4D209         49 AAMQQYMTAEMEAYAEDWKLLGKCNEVMESRCQEVRASAKDAVKELETTAGLMEHSLSQLASIDRIEAQLATLTEAVNRI 128 Trypanosoma cruzi
36_pfamImport   3 SSLENLIEADSSAILGDLDLLHKINEAARERYKAMTEAAVGLETDSEYLRGRYAELKKYTKQVDDIDERVGDLEKLVKEL 82 
55_pfamImport   5 ASLENLIRLDTESTVGDLDLLVRVNKHAAERYKAMTDAAEGLETDSEHLKAKYAEVQKYVKQVDELDERVTDLEAIVREL 84 
25_pfamImport   5 ATLENVIRADTEATVGDLDLLNRVNLHATERYKAIADAAVGLETDSEYLGQKYAEIEKYKQQVDNLDERVGDLEAIVKEL 84 
Q6CEB6          8 KAAENLIDAQTDYTVTWLDSLEVVNRKQTHKYKQLAESTKGLENDREYLEGLNNENARYVDQLKQVRGHLDTLEKLVGEV 87  Yarrowia lipol...
57_pfamImport   2 ECMRKILELDTQSTLTNFNVMETLNNSTILRYRELEPYLDSLESETSKIRALDQELAKNKPKLEQLEERTKKLALLVEQM 81 
20_pfamImport   4 TQARKLVESDTEVSTIDLNLLGNLNTNQSLNYIKLESQLTSLEKDAEQREALTQELHSLEDELTLIEKSVASLGELVEEL 83 
37_pfamImport   3 NAASKIVESDTNVSTIDLNLLENLNTNQSLNYIKLEKNLDDMETNSNQLKQLKAEFESHSQELISIENKIAILEEITTEL 82 
44_pfamImport   5 TTLSKVIESDTNISTIDLNLLENLNTNQSLNYIKLENNLNDLEANGKHLKLLKEEFDQHANLLVDIEKKVMRLEEIVNEL 84 
Q6BR74         16 NVLSKLVEADTEISTIDLNIIENLNTNQSLNYIKLEQKLNNLEDNANSLEGLNNEFKSFNTTLLEIENQINKIEIITKEL 95  Debaryomyces h...
Q4D209        129 DEYSKALADRFK 140 Trypanosoma cruzi
36_pfamImport  83 DEWCSELEVKIK 94 
55_pfamImport  85 EEWTGELEIKVR 96 
25_pfamImport  85 EEWTGELEIKVR 96 
Q6CEB6         88 DEWSKELEVKVR 99  Yarrowia lipolytica
57_pfamImport  82 DEWSAELEVKS- 92 
20_pfamImport  84 DQWSREV----- 90 
37_pfamImport  83 DQWSKQLEHNVE 94 
44_pfamImport  85 NSWSKELEMDLK 96 
Q6BR74         96 DGLSIELSSKVK 107 Debaryomyces hansenii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap