Conserved Protein Domain Family
DUF2209

?
pfam09974: DUF2209 
Uncharacterized protein conserved in archaea (DUF2209)
This domain, found in various hypothetical archaeal proteins, has no known function.
Statistics
?
PSSM-Id: 313239
View PSSM: pfam09974
Aligned: 12 rows
Threshold Bit Score: 138.639
Threshold Setting Gi: 222452629
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TY51         4 VGVDVSGRHAEEDGhYNRITACVSAEVDGFNVFTVRDVNVFVVCTREPPNLRTLTEEVSRALNGLdkD--DEY-MVVAEP 80  Methanopyrus ka...
Q12TG5         5 IAVDISGRHKIKDG-YYMVCAAVALEVSASHIESISQVAIKPFLSHDPLAVLDIVRIIEVTVSEI--A--FPG-TIVVEK 78  Methanococcoide...
Q8TK02         5 IAVDISGRHRIKDG-YYMVCAAVALTVSADHIEKVKQVKILPFWLKRAPGLLDVVQLIEDTANQL--S--FEG-TIVAEK 78  Methanosarcina ...
Q57560         1 MAIDISGRHHEN-DiFFRVYAGVLVEIKADRIVHVEKID-VMVKEEETQKLRDIVKEVKELIDKVg-D--EFD-YILCER 74  Methanocaldococ...
AGB48997       5 IAVDISGRH-VEDGeYFMVCVAVSFSVFPDHIDKTHQINIRHFTSRNAPEINDVATMVEKTVEGL--N--PQA-TIVMEA 78  Methanomethylov...
WP_013897778   5 VAVDISGRHRTSRGhYYIVCAAVSLSVSPDHIEKIHQVNTKAFRMYRPLKVLDVVQIIEKTVSNI--K--REG-VIVTEK 79  Methanosalsum z...
WP_013037859   5 IAVDISGRHRHNSr-YLMVCAAVSLSVSGGHVKQIHGVNIKPFVSDNPPEVVDVVQMIERTVEGM------EGvTIVAEE 77  Methanohalophil...
WP_014586520   4 VAVDISGRHAVA-GrYIMVSASVAARISPEGVERTRRMRLVP-RVAESVDMEVVIGLMEESVRGL------SG-VVLAER 74  Methanosaeta ha...
ACM56894      31 VGVDISGRHEEA-GeYLMVAAAVHARIDATRIRSVEGVG--FAAVRGGPTLDATVALTAEAVGNL--PepPDG-PIVAEG 104 Halorubrum lacu...
ADJ15250       2 VGIDISGRHEER-GeYLMVGAAVAASVGSNRIREVTGIG--LATSRLEPTLEATLSIADEAIGALpdL--PEG-PVVAER 75  Halalkalicoccus...
BAI62730       4 VAVDISGRHKLADGrYHLVCVAVSAVLSPFDVEKIEDMR-IYHEEADDVSVETVADLIKRAATRY------RG-AVVTEP 75  Methanocella pa...
WP_013194031   5 IAVDISGRHKIKNG-YYMVCAAVSVVSSADHVEKVNQVKIKPFWMDSAPQVTDVVRIIEDTVKEI--K--YDG-TIVAEK 78  Methanohalobium...
Q8TY51        81 GEFFGEPEWRVSALLGAPFKYAETVAEREVVEMAHKLAYGVYRGVK 126 Methanopyrus kandleri
Q12TG5        79 GDLYNQPEWLSKNMFSRDIKYQESLSEMLAIEFAHYVSLSSRKLLM 124 Methanococcoides burtonii DSM 6242
Q8TK02        79 GDMYNQPLWVPESMFSGAFKYQESLAERRAIELAHHISLSARNLLI 124 Methanosarcina acetivorans
Q57560        75 GEFFNISKDIISAILKKEVIFPKTRGELEAINIAHHVSYSVRKLLI 120 Methanocaldococcus jannaschii DSM 2661
AGB48997      79 GDMFNRPQWLVTGMFSRDFKYQESLSERRAIEIAHHISMSARRLLK 124 Methanomethylovorans hollandica DSM 15978
WP_013897778  80 GDMYNKPLNFVSSRFKGEFKYQESISERLAVQLAHHISLSSRKLLV 125 Methanosalsum zhilinae
WP_013037859  78 GDFFNQPEWLSNSMFTASFKYPESLSERMGIEIAHHISLSSRNLLL 123 Methanohalophilus mahii
WP_014586520  75 GDLYNLERWRVESILGREFKYPESRGERRAVELAHHASFAGRRLAL 120 Methanosaeta harundinacea
ACM56894     105 GEFYEEPAGRVGLSFQPEFKYVESIGERETVQAAHHAAYAARDLLL 150 Halorubrum lacusprofundi ATCC 49239
ADJ15250      76 GEFYEEPERAVGASFAPEFKYVESIGERRTIEIAHHAAYATRALIl 121 Halalkalicoccus jeotgali B3
BAI62730      76 GEFYNYPEWRVEAILGRKFKYAESVGERKAIEVAHHVSLAVHRMLH 121 Methanocella paludicola SANAE
WP_013194031  79 GDMYNKPEWVATSMFSKNFKYQESLSERLAIEMAHHISLSARNLLI 124 Methanohalobium evestigatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap