Conserved Protein Domain Family
DUF2043

?
pfam09740: DUF2043 
Uncharacterized conserved protein (DUF2043)
This is a 100 residue conserved region of a family of proteins found from fungi to humans. This region contains three conserved Cysteines and a motif of {CP}{y/l}{HG}.
Statistics
?
PSSM-Id: 313036
View PSSM: pfam09740
Aligned: 42 rows
Threshold Bit Score: 121.938
Threshold Setting Gi: 74859106
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
pfam09740 is a member of the superfamily cl10724.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 391359411 504 KAPVIPFGMDLYYWGE--EQPTAGKIIKQTSQ-----HQFWVPHEVeEEVENKELSAQMKSRCITYAGKFKPVE---HKC 573
gi 168020135 424 KAPILPYGSFLDSWGA--TSD----VPANQRGlemdnH--WGRFDS-EAMIPGDKIAEMNVRSSFYKPPEREIV----PC 490
gi 575472312 423 lAPEVPYDNDLYYWDK--QDVSFSSIS-SNAGld-fhHRFLGDGPT-DRVLSKDALSSLRKRQMYLIAEAPKNI---PAC 494
gi 302817028 401 EAPVLPWGSFLDAWGS------DAAVPANNRGlvldnH--WGRVDP-DALISTEKMAEMQVRASYY----QPLKselRPC 467
gi 224067988 406 EAPVIEWGSFLDTWGSn-RD-----VLANHRGle-leSHW-GRVDH-DAVIPAKKIAELNLQATLYKEDRVET----QPC 472
gi 297821062 404 EAPVMNWGSQLSNWDSt-TE-----VRANYRGle-leSHW-GRVDQ-DAVIPAEKIAELNLQATVYREERTET----PPC 470
gi 297745478 385 EAPLMNWGSFLDNWGSk-QD-----VLANQRGle-leGHW-GRVDY-DAVIPAEKIAELNIQTTVYKEERVDI----QPC 451
gi 565345268 408 EAPIMKWGSFLDDWGSrsRD-----VLANQRGld-ldGHW-GRVDH-DAVIPAEKIAELKVHATVYREDPVEI----QPC 475
gi 695050776 318 EAPVLSWGPFLDNWGSk-RD-----VLANQRGle-ldGHW-GRVDY-DAVIPAERIAELSVHRTVYKEEAVEI----QPC 384
gi 586753733 400 KAPVMTWGSFLDSWGMv-RD-----VPANQRGme-leCHW-GRVDY-DAVIPAEKIAELNVQMTYYNEQHGEI----RPC 466
                         90       100       110
                 ....*....|....*....|....*....|....
gi 391359411 574 KAPMPNGSLCERQDRVKCPFHGHIIPRDELGRPV 607
gi 168020135 491 RAPLKKGGLCPRRDLFRCPLHGPIIPRDDNGNPI 524
gi 575472312 495 RAPLRTGALCPRRDLVRCPVHGKIIPRDDTGTPL 528
gi 302817028 468 SAPLRNGGLCQRRDLRKCPLHGTIIPRDDRGNPL 501
gi 224067988 473 RAPLRKGGLCQRRDLRVCPFHGPIIPRDDEGNPI 506
gi 297821062 471 RAPLKKGGLCQRRDLRVCPFHGPIVPRDDEGKPI 504
gi 297745478 452 RAPLSKGGLCQRQDLRVCPFHGPIIPRDDEGKPI 485
gi 565345268 476 RAPLRNGELCQRRDLKICPFHGPIIPRDDEGKPI 509
gi 695050776 385 LAPLRKGGLCQRKDLRVCPFHGPIIPRDALGNPI 418
gi 586753733 467 FAPLKKGGLCQRRDLRVCPFHGPIVPRDVEGNPI 500
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap