Conserved Protein Domain Family
Macoilin

?
pfam09726: Macoilin 
Macoilin family
The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.
Statistics
?
PSSM-Id: 313022
View PSSM: pfam09726
Aligned: 8 rows
Threshold Bit Score: 738.584
Threshold Setting Gi: 158293256
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2TLY1         2 KRRNAD-CSKLRRPLKRNRIT-E-GIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSV 78  zebrafish
Q2TLY2         2 KRRNAD-CSKLRRPLKRNRIT-E-GIHSSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSV 78  zebrafish
AAX11930       2 KRRNIEaGKPPRRPVKRAGKFaE-GVCGSSFVYIKFILIWFFILMADFILEFRFEYMWPFWLLIQSVHDTFKYQGLAYSV 80  Pacific transpa...
XP_015792346   2 RRRNADfCGKFRRPVKKSKLT-SsGFYGSTFMYLKFLMVWSFVLFADFILEFRFEYLWPFWLLIRSVYDSFKYQGLAFSV 80  two-spotted spi...
XP_558145      2 KRRNAD-CGKIRRPIKKNKIA-E-QIGSNTLLYIKFLLLWASVITADFLLEFRFEFLWPFWLLLRSIYDSYKYKGLAFSV 78  Anopheles gambi...
AAX11923       2 KRRNAD-CSKLRRPLKRNRIT-E-GIYSSTFLYLKFLVVWVLVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSV 78  spotted green p...
XP_004082444   2 KRRNAD-CSKLRRPLKRNRIT-E-GIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSV 78  Japanese medaka
XP_010226957   1 --------------------------mhSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSV 54  Tinamus guttatus
Q2TLY1        79 FFVCVAFTSDIICLLFIPVQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKH--FHVDLCRPFAA 156 zebrafish
Q2TLY2        79 FFVCVAFTSDIICLLFIPKQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKH--FHVDLCRPFAA 156 zebrafish
AAX11930      81 FFVCIAITSDTVCLLFIPIQWLFFMASTYVWIHYVWHTDKGICIPTVSLWLFFMYIEATMRLRDLKNspFHIDLCRPFAA 160 Pacific transpa...
XP_015792346  81 FFVFIALTSDMICFLLIPVHWLFFVASTYVWVQYVWHTEKGICLPTLSLWLLFVYIEASFRLKELKNlpFHLDLCRPFAA 160 two-spotted spi...
XP_558145     79 LFVCIAVTSDLVCLFFIPVQWLFFAASTYVWVQYVWHTDKGICLPTIILWILFVYLEAAIRWKDSRNi-pHLNLCRPFAA 157 Anopheles gambi...
AAX11923      79 FFVCVAFTSDIICLLFIPVQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKN--FHVDLCRPFAA 156 spotted green p...
XP_004082444  79 FFVCVAFTSDIICLLFIPVQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKN--FHVDLCRPFAA 156 Japanese medaka
XP_010226957  55 FFVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKN--FHVDLCRPFAA 132 Tinamus guttatus
Q2TLY1       157 HCIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----LIQRQEREAEEaaAAAAAAA 226 zebrafish
Q2TLY2       157 HCIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----MLQRQERETEE--ATSKGMS 224 zebrafish
AAX11930     161 HCIGHPVVTLGIGFKSYVSYRFKLRMQREVQKENVFFYELLRQALPKEQ-----PnhtlsVTDKEKSETST---TSNGVL 232 Pacific transpa...
XP_015792346 161 HCIGYSVVTLGFGFKSHVSYKMRLRKQSEVAKENEFYFELLQKALPQET-----C-----ATN-----LTD--NTSVISN 223 two-spotted spi...
XP_558145    158 HCIGYPVVTLGFGFKSYVGFRIRQRKQREVAKDNDFYMQLLQEALPKEEsraleP-----LADGATGAGSEqlTSTKELV 232 Anopheles gambi...
AAX11923     157 HCIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----MLQRPEKETEE---VTKGIS 223 spotted green p...
XP_004082444 157 HCIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----MLQRQEREAEE---AAKGAS 223 Japanese medaka
XP_010226957 133 HCIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----MLQRQEREAEE---AAKGLS 199 Tinamus guttatus
Q2TLY1       227 sksihDVD-SPAVAQNGSAGGKKp-----SSNTLPELEYREK---ERGK-NESKKQHNhnqnhhsstsssilPSVDNKAQ 296 zebrafish
Q2TLY2       225 -----EAD-SVLVAQNGTAINKK------LPISLPELEYKEK---GKDS-AKDKKQQQhsigi----nnnilQTVDAKLQ 284 zebrafish
AAX11930     233 ---------PNHLNKKPHDRSKIpai-qdSTLQIAEINSSNHkssGAASgTPT-------------------------VT 277 Pacific transpa...
XP_015792346 224 -----CVPlPLALNHNHHSLNNKkaisgsSNEKTPTVSHNSSnisKLNNeYDSKKSYA--------------NGID--KQ 282 two-spotted spi...
XP_558145    233 ---------PVATSGNNHSLNS-------------------SsnsATSNrSDTGQHHHhnh--------hnhNHHHHNHQ 276 Anopheles gambi...
AAX11923     224 -----EVE-PSVTSQNGAPPGKKs-----STLQLPELEYREK---AKDStGKEGKKvgin--------nnsiIHLDSKLQ 281 spotted green p...
XP_004082444 224 -----EVE-TLPVTQNGAPPNKK------TSVPLPELEYREKgkdGRGG-GEAKKQHNsnn--------ilqPSLDSKIH 282 Japanese medaka
XP_010226957 200 -----DMDsSILLQHNGGIPANKk-----LSATLPELEYREK---GKEK-DKDAKKHNlgin------nnilQPVDSKIQ 259 Tinamus guttatus
Q2TLY1       297 EMEYMENHVNSKRLSSSdLLGSTENLLKDEHSSSSSSSTSSns-----------------nKNYKnasgggggggSSSPR 359 zebrafish
Q2TLY2       285 DIEYMENHLNAKRLNNE-LGGSAENLFLKEEVGAGGGSAPS--------------------KHYK----------NSSPR 333 zebrafish
AAX11930     278 RKSGHTNKSEPTPV-ITtSPTPETDLKRRSSARDKKTTDLSh------------------sPTQKttkt---nsgNSSPK 335 Pacific transpa...
XP_015792346 283 ELQFMENPINKKPLSEYeNDSNISDCNHEESFKNLTSSLSPn-------------------KSTEkltnsmasisLSSSN 343 two-spotted spi...
XP_558145    277 QQQHHASHSKSAQSYKSsSSGSSSTTHVNGHVSSGSSPSSSstngsgqslaarkdydkettSNSSsaaagsigssSSSSA 356 Anopheles gambi...
AAX11923     282 EAEYIENYAGAKRLNND---------LAGENTDSNTHSTSKeema-------------gtgKNFKynsggganisNSSPR 339 spotted green p...
XP_004082444 283 EMEYMENHMN-KRLTTE--LDSTESLLLKEDNNSSCSSSSSss-----------------sKNYKnassn-aaalNSSPR 341 Japanese medaka
XP_010226957 260 EIEYMENHINSKRLNND-LVGSTENLLKEDSCTASS-------------------------KNYKnvs----gvvNSSPR 309 Tinamus guttatus
Q2TLY1       360 GHGTANGSVPSSSgpsssassSSKGDRKQ-----------------------------KYgGGKNS-A--SHRDPVEN-- 405 zebrafish
Q2TLY2       334 SHNSTNGSVPSSS--------SNRSDKKQ-----------------------------KC-TGKNL-A--PHRDLMEN-- 370 zebrafish
AAX11930     336 SLKHNSSSRSSSTh--------SNDSEKP-----------------------------KQpSLPNGhA--VMKEPIML-- 374 Pacific transpa...
XP_015792346 344 KLNHSSNHVTSSNs--------NANS---------------------------------LpFGNVQ-SlnISNKKTKN-- 379 two-spotted spi...
XP_558145    357 KHSNRSKSPTESSthsvavgsSKSNSNKQnghissqyhqpelvqqvactevatagsesKGgGGRSG-RknRLKKAAEQqa 435 Anopheles gambi...
AAX11923     340 NHSSSNGSVLSGS--------TSKNEKKQ-----------------------------KG-AGK------AQKDPVEN-- 373 spotted green p...
XP_004082444 342 GHSTTNGSVAFSAsss--ttnTAKNDKKH-----------------------------KLpVGKGT-AggSHKDPADN-- 387 Japanese medaka
XP_010226957 310 SHSATNGSIPSSS---------TKNEKKQ-----------------------------KC-ASKSP-S--THKDLMEN-- 345 Tinamus guttatus
Q2TLY1       406 --------------------------------------------------CIPNNQL----------------------- 412 zebrafish
Q2TLY2       371 --------------------------------------------------CIPNNQL----------------------- 377 zebrafish
AAX11930     375 --------------------------------------------------PLTNGHAvqekgne---------------t 389 Pacific transpa...
XP_015792346 380 --------------------------------------------------NLANNLT----------------------- 386 two-spotted spi...
XP_558145    436 qlsaiaklcatlalassvttlttaagatlssggggdnattitsasytgagSVPSASVkdnhqhnseqvkesgdgrsssss 515 Anopheles gambi...
AAX11923     374 --------------------------------------------------CIPNNQL----------------------- 380 spotted green p...
XP_004082444 388 --------------------------------------------------WIPNNQL----------------------- 394 Japanese medaka
XP_010226957 346 --------------------------------------------------CIPNNQL----------------------- 352 Tinamus guttatus
Q2TLY1       413 -----SKPEA-------------------------------------------LV-RLEQDVKKLKADLQASRQTEQDLR 443 zebrafish
Q2TLY2       378 -----SKPDA-------------------------------------------LV-RLEQDIKKLKADLQASRQVEQDLR 408 zebrafish
AAX11930     390 kieliCTPSA-------------------------------------------IE-RLETTIAKLQAELAQARKNDSELN 425 Pacific transpa...
XP_015792346 387 -----SQKDE-------------------------------------------LViRLEADIKRLKAYLQASRQTELELK 418 two-spotted spi...
XP_558145    516 sgardSKKDAsgmsangtakatpaaagsssgqassagvappvattvvvqkvceSCpRLEGDLKKLRAELSTHRQTENELR 595 Anopheles gambi...
AAX11923     381 -----GKPDA-------------------------------------------LV-RLEQDVKRLKTDLQANRQLESELR 411 spotted green p...
XP_004082444 395 -----SKPEA-------------------------------------------LV-RLEQDIKKLKADLQASRQVEQDLR 425 Japanese medaka
XP_010226957 353 -----SKPDA-------------------------------------------LV-RLEQDIKKLKADLQASRQVEQELR 383 Tinamus guttatus
Q2TLY1       444 SQLGSLGTSERSIRSELGQLRQENELLQNKLHNAVQAKQKDKQTLGQLEKRLKAEQEARAAAEKLLAEEKKRKKLEEATA 523 zebrafish
Q2TLY2       409 SQISSLSSAERSMRSELGQLRQENELLQNKLHNAVQAKQKDKQTIVQLEKRLKAEQEARAAVEKQLAEEKKRKKMEEATA 488 zebrafish
AAX11930     426 NRINLLTNLERAAKNDIIQLKKENDMMQTKMNGMMSSKQKEKQSMQSMEKRLKSEADSRVNAEKLLQEEKRRKREEEDTA 505 Pacific transpa...
XP_015792346 419 SQINSLLSEERSLKSELSTLQQDNDSLQTRLHNLLSARQQDKQTVSQLEKRLQEEKKSRASYESQLASERKAKKDEANA- 497 two-spotted spi...
XP_558145    596 QKYDSNTG---NLKSCLQAKQKEYDELQTRYQELSSQRQQERQNLQTVERRLGEERRHRQSLEAQLNNERKYRKQAEEKA 672 Anopheles gambi...
AAX11923     412 SQLSSLSSQDRSLRSELGQLRQDNELLQNKLHSAVQAKQKDKQTISQLEKRLKAEQEARTLAEKQLAEERKRKKMEEATA 491 spotted green p...
XP_004082444 426 SQISSLGSAERSIRTELGQLRQENELLQNKLHNAVQAKQKDKQTVGQLEKKLKGEQEARATAEKQLAEEKKRKKLEEATA 505 Japanese medaka
XP_010226957 384 SQISSLANTERGIRSEIGQLRQENELLQNKLHNAVQMKQKDKQMISQLEKKLKAEQEARAFVEKQLMDEKKRKKLEEATA 463 Tinamus guttatus
Q2TLY1       524 ARAVALAAATR-GECTESLRRRISELEAECKKLTLDI-------KVKEDQIRELELKVQELHKY------KENEKDTEVL 589 zebrafish
Q2TLY2       489 ARAVALAAASR-GECTDSLKSRIRELESECKKLTHDM-------KLKEEQIRELELKAQELHKY------KENEKDTEVL 554 zebrafish
AAX11930     506 KQAAAQAITSReRERAEVLKQAKQDLELEIQRLETKL-------RIKEEECAALK---KEIVDYqv---qEKSVKESETL 572 Pacific transpa...
XP_015792346 498 ---RAAAAAAR-IECTEICKNKRRELESELKLLRKEI-------KVREDQVKQIDCEAQSLRQY------KESHGDTEIL 560 two-spotted spi...
XP_558145    673 AR----------SECGESCKMKKQQMEMEIDKLQHEVinaeegkLMAEKQARNYE---QEMRKYelqlrsRESQPNTEVL 739 Anopheles gambi...
AAX11923     492 ARAVALAAATR-VESTDSLRSRIRDLETECKKLTMDM-------KLKEEQIRDLEGKCQELRKY------KENEKDTEVL 557 spotted green p...
XP_004082444 506 ARAVALAAASR-GECTDTLRRRITELETECKKLTMDI-------KLKEDQIRELEIKVQELHKY------KENEKDTEVL 571 Japanese medaka
XP_010226957 464 ARAVA-FAATR-GECTETLRNRIRELETECKKLTIDI-------KLKEDQiRELEMKVQELRKY------KENEKDTEVL 528 Tinamus guttatus
Q2TLY1       590 MSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKDQEIKD-------LKQKIAEVMAVMPSvvys 662 zebrafish
Q2TLY2       555 MSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKEQEIKE-------LKQKIAEVMAVMPSitys 627 zebrafish
AAX11930     573 MSALQAMQDKNLMLENSLSAETRLKLDLFSALGDVKRQLELAHGAIYKRDAEIVD-------LKSRLADILSILPE---- 641 Pacific transpa...
XP_015792346 561 LSALSAMQDKNAHLENSLSAETRLKLDLFSALGEAKRQLEINQALLQQKERQIEElestvdqLKARFTELLAVMPA---- 636 two-spotted spi...
XP_558145    740 ISALAVMREKNETLEKNLSAETRVKLDLFSALGGTRREVEILTCSLRSKEKEILD-------LNAKIVQLVAVMP----- 807 Anopheles gambi...
AAX11923     558 MSALSAMQEKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQIHQREQEIAE-------LKQKIAEVMAVMPSlsys 630 spotted green p...
XP_004082444 572 MSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQMIQKDQEIKD-------LKQKIAEVMAVMPSisyt 644 Japanese medaka
XP_010226957 529 MSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQIIQKDQEIKD-------LKQKIAEVMAVMPSityt 601 Tinamus guttatus
Q2TLY1       663 adTGSMTPVTPHYSSKFMDTSPSGLDPNASVYQPL 697 zebrafish
Q2TLY2       628 aeTNNMTPVTPHYSSKFMDTSPSSLDPNASVYQPL 662 zebrafish
AAX11930     642 ---SRIRSPTPHYSANFLEKPPLVRLSPTQEYPNN 673 Pacific transparent sea squirt
XP_015792346 637 --TNAYTGIDSDIVSSLMLNSKFMPDPNDShessm 669 two-spotted spider mite
XP_558145    808 ---NDALGLTSHGGGGGTDGSSMMRladapql--- 836 Anopheles gambiae str. PEST
AAX11923     631 sdGSNLSPVTPHYSSKFMDNSPSSLDPNASVYQPL 665 spotted green pufferfish
XP_004082444 645 tdTSSMTPVAPHYSSKFMDTSPSGLDPNASVYQPL 679 Japanese medaka
XP_010226957 602 aaTSTLSPVSPHYSSKFVETSPSGLDPNASVYQPL 636 Tinamus guttatus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap