Conserved Protein Domain Family
Macoilin

?
pfam09726: Macoilin 
Macoilin family
The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.
Statistics
?
Aligned: 9 rows
Threshold Bit Score: 737.824
Threshold Setting Gi: 158293256
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2TLY1         2 KRRNAD-CSKLRRPLKRNRIT-EGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 79  zebrafish
XP_004082444   2 KRRNAD-CSKLRRPLKRNRIT-EGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 79  Japanese medaka
Q2TLY2         2 KRRNAD-CSKLRRPLKRNRIT-EGIHSSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 79  zebrafish
3_pfamImport   1 KRRNIEaGKPPRRPVKRAGKFaEGVCGSSFVYIKFILIWFFILMADFILEFRFEYMWPFWLLIQSVHDTFKYQGLAYSVF 80 
XP_015792346   2 RRRNADfCGKFRRPVKKSKLTsSGFYGSTFMYLKFLMVWSFVLFADFILEFRFEYLWPFWLLIRSVYDSFKYQGLAFSVF 81  two-spotted spi...
AAX11930       2 KRRNIEaGKPPRRPVKRAGKFaEGVCGSSFVYIKFILIWFFILMADFILEFRFEYMWPFWLLIQSVHDTFKYQGLAYSVF 81  Pacific transpa...
XP_558145      2 KRRNAD-CGKIRRPIKKNKIA-EQIGSNTLLYIKFLLLWASVITADFLLEFRFEFLWPFWLLLRSIYDSYKYKGLAFSVL 79  Anopheles gambi...
AAX11923       2 KRRNAD-CSKLRRPLKRNRIT-EGIYSSTFLYLKFLVVWVLVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 79  spotted green p...
XP_010226957   1 -------------------------mhSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVF 55  white-throated ...
Q2TLY1        80 FVCVAFTSDIICLLFIPVQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKH--FHVDLCRPFAAH 157 zebrafish
XP_004082444  80 FVCVAFTSDIICLLFIPVQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKN--FHVDLCRPFAAH 157 Japanese medaka
Q2TLY2        80 FVCVAFTSDIICLLFIPKQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKH--FHVDLCRPFAAH 157 zebrafish
3_pfamImport  81 FVCIAITSDTVCLLFIPIQWLFFMASTYVWIHYVWHTDKGICIPTVSLWLFFMYIEATMRLRDLKNspFHIDLCRPFAAH 160
XP_015792346  82 FVFIALTSDMICFLLIPVHWLFFVASTYVWVQYVWHTEKGICLPTLSLWLLFVYIEASFRLKELKNlpFHLDLCRPFAAH 161 two-spotted spi...
AAX11930      82 FVCIAITSDTVCLLFIPIQWLFFMASTYVWIHYVWHTDKGICIPTVSLWLFFMYIEATMRLRDLKNspFHIDLCRPFAAH 161 Pacific transpa...
XP_558145     80 FVCIAVTSDLVCLFFIPVQWLFFAASTYVWVQYVWHTDKGICLPTIILWILFVYLEAAIRWKDSRNi-pHLNLCRPFAAH 158 Anopheles gambi...
AAX11923      80 FVCVAFTSDIICLLFIPVQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKN--FHVDLCRPFAAH 157 spotted green p...
XP_010226957  56 FVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGVCLPTVSLWILFVYIEAAIRFKDLKN--FHVDLCRPFAAH 133 white-throated ...
Q2TLY1       158 CIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----LIQRQEREAEEaaaAAAAAAs 227 zebrafish
XP_004082444 158 CIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----MLQRQEREAEE---AAKGAS- 223 Japanese medaka
Q2TLY2       158 CIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----MLQRQERETEEa--TSKGMS- 224 zebrafish
3_pfamImport 161 CIGHPVVTLGIGFKSYVSYRFKLRMQREVQKENVFFYELLRQALPKEQpnhtlS-----VTDKEKSETST---TSNGVL- 231
XP_015792346 162 CIGYSVVTLGFGFKSHVSYKMRLRKQSEVAKENEFYFELLQKALPQET-------------------------CATNLTd 216 two-spotted spi...
AAX11930     162 CIGHPVVTLGIGFKSYVSYRFKLRMQREVQKENVFFYELLRQALPKEQ-----PnhtlsVTDKEKSETST---TSNGVL- 232 Pacific transpa...
XP_558145    159 CIGYPVVTLGFGFKSYVGFRIRQRKQREVAKDNDFYMQLLQEALPKEEsraleP-----LADGATGAGSEqltSTKELV- 232 Anopheles gambi...
AAX11923     158 CIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----MLQRPEKETEE---VTKGIS- 223 spotted green p...
XP_010226957 134 CIGYPVVTLGFGFKSYVSYKMRLRKQKEVQKENEFYMQLLQQALPPEQ-----Q-----MLQRQEREAEE---AAKGLS- 199 white-throated ...
Q2TLY1       228 ks---ihDVD-SPAVAQNGSAGGKKp-----SSNTLPELEYREK---ERGK-NESKKQHNhnqnhhsstsssilPSVDNK 294 zebrafish
XP_004082444 224 -------EVE-TLPVTQNGAPPNKK------TSVPLPELEYREKgkdGRGG-GEAKKQHNsnn--------ilqPSLDSK 280 Japanese medaka
Q2TLY2       225 -------EAD-SVLVAQNGTAINKK------LPISLPELEYKEK---GKDS-AKDKKQQQhsigi----nnnilQTVDAK 282 zebrafish
3_pfamImport 232 -----------PNHLNKKPHDRSKIpai-qdSTLQIAEINSSNHkssGAASgTPT------------------------- 274
XP_015792346 217 ntsvisnCVPlPLALNHNHHSLNNKkaisgsSNEKTPTVSHNSSnisKLNNeYDSKKSYAng----------------id 280 two-spotted spi...
AAX11930     233 -----------PNHLNKKPHDRSKIpai-qdSTLQIAEINSSNHkssGAASgTPT------------------------- 275 Pacific transpa...
XP_558145    233 -----------PVATSGNNHSLNS-------------------SsnsATSNrSDTGQHHHhnh--------hnhNHHHHN 274 Anopheles gambi...
AAX11923     224 -------EVE-PSVTSQNGAPPGKKs-----STLQLPELEYREK---AKDStGKEGKKvgin--------nnsiIHLDSK 279 spotted green p...
XP_010226957 200 -------DMDsSILLQHNGGIPANKk-----LSATLPELEYREK---GKEK-DKDAKKHNlgin------nnilQPVDSK 257 white-throated ...
Q2TLY1       295 AQEMEYMENHVNsKRLSSSdlLGSTENLLKDEHSSSSSSSTSSNSn-----------------KNYKNASGGGGgGGSSS 357 zebrafish
XP_004082444 281 IHEMEYMENHMN-KRLTTE--LDSTESLLLKEDNNSSCSSSSSSSs-----------------KNYKNASSNAA-ALNSS 339 Japanese medaka
Q2TLY2       283 LQDIEYMENHLNaKRLNNEl-GGSAENLFLKEEVGAGGGSAPS--------------------KHYK----------NSS 331 zebrafish
3_pfamImport 275 VTRKSGHTNKSEpTPV-ITtsPTPETDLKRRSSARDKKTTDLSHS------------------PTQKTTKTn---SGNSS 332
XP_015792346 281 KQELQFMENPINkKPLSEYenDSNISDCNHEESFKNLTSSLSPN-------------------KSTEKLTNSMAsISLSS 341 two-spotted spi...
AAX11930     276 VTRKSGHTNKSEpTPV-ITtsPTPETDLKRRSSARDKKTTDLSHS------------------PTQKTTKTn---SGNSS 333 Pacific transpa...
XP_558145    275 HQQQQHHASHSKsAQSYKSssSGSSSTTHVNGHVSSGSSPSSSSTngsgqslaarkdydkettSNSSSAAAGSIgSSSSS 354 Anopheles gambi...
AAX11923     280 LQEAEYIENYAGaKRLNND---------LAGENTDSNTHSTSKEEmag-------------tgKNFKYNSGGGAnISNSS 337 spotted green p...
XP_010226957 258 IQEIEYMENHINsKRLNNDl-VGSTENLLKEDSCTASS-------------------------KNYKNVSG----VVNSS 307 white-throated ...
Q2TLY1       358 PRGHGTANGSVPSSSgpsssassSSKGDRKQ-----------------------------KYGGGKNS-A--SHRDPVEN 405 zebrafish
XP_004082444 340 PRGHSTTNGSVAFSAsss--ttnTAKNDKKH-----------------------------KLPVGKGT-AggSHKDPADN 387 Japanese medaka
Q2TLY2       332 PRSHNSTNGSVPSSS--------SNRSDKKQ-----------------------------KC-TGKNL-A--PHRDLMEN 370 zebrafish
3_pfamImport 333 PKSLKHNSSSRSSST--------HSNDSEKP-----------------------------KLP----------------- 358
XP_015792346 342 SNKLNHSSNHVTSSN--------SNAN---------------------------------SLPFGNVQ-SlnISNKKTKN 379 two-spotted spi...
AAX11930     334 PKSLKHNSSSRSSSTh--------SNDSEKP-----------------------------KQPSLPNGhA--VMKEPIML 374 Pacific transpa...
XP_558145    355 SAKHSNRSKSPTESSthsvavgsSKSNSNKQnghissqyhqpelvqqvactevatagsesKGGGGRSG-RknRLKKAAEQ 433 Anopheles gambi...
AAX11923     338 PRNHSSSNGSVLSGS--------TSKNEKKQ-----------------------------KG-AGK------AQKDPVEN 373 spotted green p...
XP_010226957 308 PRSHSATNGSIPSSS---------TKNEKKQ-----------------------------KC-ASKSP-S--THKDLMEN 345 white-throated ...
Q2TLY1       406 ----------------------------------------------------CIPNNQL--------------------- 412 zebrafish
XP_004082444 388 ----------------------------------------------------WIPNNQL--------------------- 394 Japanese medaka
Q2TLY2       371 ----------------------------------------------------CIPNNQL--------------------- 377 zebrafish
3_pfamImport 359 ----------------------------------------------------SLPNGHAvmkepimlpltnghavqekgn 386
XP_015792346 380 ----------------------------------------------------NLANNLT--------------------- 386 two-spotted spi...
AAX11930     375 ----------------------------------------------------PLTNGHAvqekgne-------------- 388 Pacific transpa...
XP_558145    434 qaqlsaiaklcatlalassvttlttaagatlssggggdnattitsasytgagSVPSASVkdnhqhnseqvkesgdgrsss 513 Anopheles gambi...
AAX11923     374 ----------------------------------------------------CIPNNQL--------------------- 380 spotted green p...
XP_010226957 346 ----------------------------------------------------CIPNNQL--------------------- 352 white-throated ...
Q2TLY1       413 -------SKPEA-------------------------------------------LV-RLEQDVKKLKADLQASRQTEQD 441 zebrafish
XP_004082444 395 -------SKPEA-------------------------------------------LV-RLEQDIKKLKADLQASRQVEQD 423 Japanese medaka
Q2TLY2       378 -------SKPDA-------------------------------------------LV-RLEQDIKKLKADLQASRQVEQD 406 zebrafish
3_pfamImport 387 etkieliCTPSA-------------------------------------------IE-RLETTIAKLQAELAQARKNDSE 422
XP_015792346 387 -------SQKDE-------------------------------------------LViRLEADIKRLKAYLQASRQTELE 416 two-spotted spi...
AAX11930     389 -tkieliCTPSA-------------------------------------------IE-RLETTIAKLQAELAQARKNDSE 423 Pacific transpa...
XP_558145    514 sssgardSKKDAsgmsangtakatpaaagsssgqassagvappvattvvvqkvceSCpRLEGDLKKLRAELSTHRQTENE 593 Anopheles gambi...
AAX11923     381 -------GKPDA-------------------------------------------LV-RLEQDVKRLKTDLQANRQLESE 409 spotted green p...
XP_010226957 353 -------SKPDA-------------------------------------------LV-RLEQDIKKLKADLQASRQVEQE 381 white-throated ...
Q2TLY1       442 LRSQLGSLGTSERSIRSELGQLRQENELLQNKLHNAVQAKQKDKQTLGQLEKRLKAEQEARAAAEKLLAEEKKRKKLEEA 521 zebrafish
XP_004082444 424 LRSQISSLGSAERSIRTELGQLRQENELLQNKLHNAVQAKQKDKQTVGQLEKKLKGEQEARATAEKQLAEEKKRKKLEEA 503 Japanese medaka
Q2TLY2       407 LRSQISSLSSAERSMRSELGQLRQENELLQNKLHNAVQAKQKDKQTIVQLEKRLKAEQEARAAVEKQLAEEKKRKKMEEA 486 zebrafish
3_pfamImport 423 LNNRINLLTNLERAAKNDIIQLKKENDMMQTKMNGMMSSKQKEKQSMQSMEKRLKSEADSRVNAEKLLQEEKRRKREEED 502
XP_015792346 417 LKSQINSLLSEERSLKSELSTLQQDNDSLQTRLHNLLSARQQDKQTVSQLEKRLQEEKKSRASYESQLASERKAKKDE-- 494 two-spotted spi...
AAX11930     424 LNNRINLLTNLERAAKNDIIQLKKENDMMQTKMNGMMSSKQKEKQSMQSMEKRLKSEADSRVNAEKLLQEEKRRKREEED 503 Pacific transpa...
XP_558145    594 LRQKYDSNTG---NLKSCLQAKQKEYDELQTRYQELSSQRQQERQNLQTVERRLGEERRHRQSLEAQLNNERKYRKQAEE 670 Anopheles gambi...
AAX11923     410 LRSQLSSLSSQDRSLRSELGQLRQDNELLQNKLHSAVQAKQKDKQTISQLEKRLKAEQEARTLAEKQLAEERKRKKMEEA 489 spotted green p...
XP_010226957 382 LRSQISSLANTERGIRSEIGQLRQENELLQNKLHNAVQMKQKDKQMISQLEKKLKAEQEARAFVEKQLMDEKKRKKLEEA 461 white-throated ...
Q2TLY1       522 TAARAVALAAATR-GECTESLRRRISELEAECKKLTLDI-------KVKEDQIRELELKVQELHKY------KENEKDTE 587 zebrafish
XP_004082444 504 TAARAVALAAASR-GECTDTLRRRITELETECKKLTMDI-------KLKEDQIRELEIKVQELHKY------KENEKDTE 569 Japanese medaka
Q2TLY2       487 TAARAVALAAASR-GECTDSLKSRIRELESECKKLTHDM-------KLKEEQIRELELKAQELHKY------KENEKDTE 552 zebrafish
3_pfamImport 503 TAKQAAAQAITSReRERAEVLKQAKQDLELEIQRLETKL-------RIKEEECAALK---KEIVDYqv---qEKSVKESE 569
XP_015792346 495 --ANARAAAAAAR-IECTEICKNKRRELESELKLLRKEI-------KVREDQVKQIDCEAQSLRQY------KESHGDTE 558 two-spotted spi...
AAX11930     504 TAKQAAAQAITSReRERAEVLKQAKQDLELEIQRLETKL-------RIKEEECAALK---KEIVDYqv---qEKSVKESE 570 Pacific transpa...
XP_558145    671 KAAR----------SECGESCKMKKQQMEMEIDKLQHEVinaeegkLMAEKQARNYE---QEMRKYelqlrsRESQPNTE 737 Anopheles gambi...
AAX11923     490 TAARAVALAAATR-VESTDSLRSRIRDLETECKKLTMDM-------KLKEEQIRDLEGKCQELRKY------KENEKDTE 555 spotted green p...
XP_010226957 462 TAARAVA-FAATR-GECTETLRNRIRELETECKKLTIDI-------KLKEDQiRELEMKVQELRKY------KENEKDTE 526 white-throated ...
Q2TLY1       588 VLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKDQEIKD-------LKQKIAEVMAVMPSvv 660 zebrafish
XP_004082444 570 VLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQMIQKDQEIKD-------LKQKIAEVMAVMPSis 642 Japanese medaka
Q2TLY2       553 VLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKEQEIKE-------LKQKIAEVMAVMPSit 625 zebrafish
3_pfamImport 570 TLMSALQAMQDKNLMLENSLSAETRLKLDLFSALGDVKRQLELAHGAIYKRDAEIVD-------LKSRLADILSILPE-- 640
XP_015792346 559 ILLSALSAMQDKNAHLENSLSAETRLKLDLFSALGEAKRQLEINQALLQQKERQIEElestvdqLKARFTELLAVMPA-- 636 two-spotted spi...
AAX11930     571 TLMSALQAMQDKNLMLENSLSAETRLKLDLFSALGDVKRQLELAHGAIYKRDAEIVD-------LKSRLADILSILPE-- 641 Pacific transpa...
XP_558145    738 VLISALAVMREKNETLEKNLSAETRVKLDLFSALGGTRREVEILTCSLRSKEKEILD-------LNAKIVQLVAVMP--- 807 Anopheles gambi...
AAX11923     556 VLMSALSAMQEKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQIHQREQEIAE-------LKQKIAEVMAVMPSls 628 spotted green p...
XP_010226957 527 VLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQIIQKDQEIKD-------LKQKIAEVMAVMPSit 599 white-throated ...
Q2TLY1       661 ysadTGSMTPVTPHYSSKFMDTSPSGLDPNASVYQPL 697 zebrafish
XP_004082444 643 yttdTSSMTPVAPHYSSKFMDTSPSGLDPNASVYQPL 679 Japanese medaka
Q2TLY2       626 ysaeTNNMTPVTPHYSSKFMDTSPSSLDPNASVYQPL 662 zebrafish
3_pfamImport 641 -----SRIRSPTPHYSANFLEKPPLVRLSPTQEYPNN 672
XP_015792346 637 ----TNAYTGIDSDIVSSLMLNSKFMPDPNDS--HES 667 two-spotted spider mite
AAX11930     642 -----SRIRSPTPHYSANFLEKPPLVRLSPTQEYPNN 673 Pacific transparent sea squirt
XP_558145    808 -----NDALGLTSHGGGGGTDGSSMMRladapql--- 836 Anopheles gambiae str. PEST
AAX11923     629 yssdGSNLSPVTPHYSSKFMDNSPSSLDPNASVYQPL 665 spotted green pufferfish
XP_010226957 600 ytaaTSTLSPVSPHYSSKFVETSPSGLDPNASVYQPL 636 white-throated tinamou
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap