Conserved Protein Domain Family
DUF2400

?
pfam09674: DUF2400 
Protein of unknown function (DUF2400)
Members of this uncharacterized protein family are found sporadically, so far only among spirochetes, epsilon and delta proteobacteria, and Bacteroides. The function is unknown and its gene neighborhoods show little conservation.
Statistics
?
PSSM-Id: 337471
View PSSM: pfam09674
Aligned: 143 rows
Threshold Bit Score: 201.951
Threshold Setting Gi: 81665638
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q73Q40        28 DPISIPHRFSKK--E-----DIEIAGFFVSIFAWGNRTSILKSADKLMDILQNQPHAFLT--QST-PAQLKIINTFYHRT 97  Treponema denti...
CDE98072      23 DPVQFPHKFEDK--K-----SIELAGFIASLVAYGSRQQFIKKLNELFDLAEHEPLNFIQ--NFEpKI----LGDFNYRF 89  Clostridium sp....
CCZ50903      23 DPIQFLHRFNDKgkE-----DAELAGFIASLFAYGNRKMFISKLNDLFARADNDIANYVK--NGDfAN----LKGMEYRF 91  Acinetobacter s...
ABZ94384      28 DPICFPKQYKNP--L-----DIELVSLISCLFAYGNVKNIQNFLKPIFLEMGPSPYEFFVysNPSfSKFLNSQKG--YRF 98  Leptospira bifl...
WP_013450498  49 DPIFFPSSYSG---------NKEYVAFVSALFAYGRVNLIKDFLIRFFDYYGNDPNNNLV--QES--------SSVYYRF 109 Calditerrivibri...
CDB10907      24 DPLQVVKSMIEK--KpnsigDIEICAILTTTIAWGQREQIIKTANSIMNYCNWQPLEFIK--YGDfYDIPD--EQNIYRT 97  Bacteroides sp....
WP_013886051  44 DPIIFPSTIEG---------NKEYISLVSSLFAYGRVNSIQDFLKKFFYRYGNDPFD--T--DNSeAKL-------YYRF 103 Flexistipes sin...
WP_013007882  21 DPIIYPH--TIK--G-----DIEFIAFISSIFAYGRVASINKFLKLFFDLYGFYPNR------------VKTKKNIYYRF 79  Deferribacter d...
CCY23565      23 DPVRFPNRFTEK--K-----DIEIAGFIASLVAYGRRDVFIKKLNTLFELAQNEPLNFIM--NFEpQILGDF----NYRF 89  Brachyspira sp....
CDE59577      23 DPVRVPNRFTDK--K-----DIEIAGFIASIVAYGRREVFLKKLDTLFEIAQNEPLNFIL--NFEsKILGDF----NYRF 89  Fusobacterium s...
Q73Q40        98 LNGKDSLAIAKAIRRIY--LSGSN--FEELFKA---KNQD-EPLISRMSRFRKEF--IKn------mDP-H--NTK---H 155 Treponema denti...
CDE98072      90 GKPDDFAEIFLILKELY--NTSDG--LEELFAY---GFSQ-EKMFECVVDYFYSR--ASe------kAK-----QGfyqM 148 Clostridium sp....
CCZ50903      92 AKDYDIIPVFEILNKLY--SSSKG--LEELFSY---AFKS-ENF---LQTVVDYF--YSn------aPKtA--EHGfyhM 150 Acinetobacter s...
ABZ94384      99 QTKEDVIVLFLTLQRILtkKKQTSplFESYFLD---TNGR-FDQNTSIQNFQKHF--ETelistlktET-L--SYGlqfL 169 Leptospira bifl...
WP_013450498 110 QTSKDIFNLYGMITEIY--EKYGS--IEGAFLS---FSDE---LEEALKRFVLYC--REf------gRK-RllDRGffqL 170 Calditerrivibri...
CDB10907      98 LKGKAFKEMCHKMRLFY--NKYDS--IQNAIIQ---KKASvGDLIDLLSNW------------------------GesaR 146 Bacteroides sp....
WP_013886051 104 QTAEDIRLLVTMIKGIY--LQYGS--VQNFFV-----NIS-DSLEKALEGFLDYArgFGa------eNN-A--GRGyffL 164 Flexistipes sin...
WP_013007882  80 QSSDDIYNFLNFLKNIF--QSYGS--LYD-FLL---KINP-NDLDAAYKGFHEYY--LEy------fGN-Kl-TQGlrfL 140 Deferribacter d...
CCY23565      90 GKPDDFAQIFSIMRTLY--EKDGG--LEELFKYgyeTKPK-GNMFIPVTDYFYAR--AK--------EN-S--GQGfyfM 151 Brachyspira sp....
CDE59577      90 GKPDDFAQIFMIMRDLY--SKQGG--LEELFKYgyeNPVS-DNMFIPITDYFYSR--AK--------DN-T--SQGfrfM 151 Fusobacterium s...
Q73Q40       156 IADMEGGSAAKRLNMFLRWMVRSKdkGVDFGLWKS--VKPSELYLPLDVHCARRGRALGLLTRKQNDRKAVEEITERLRE 233 Treponema denti...
CDE98072     149 IPNPHNGGAMKRMCMFLRWMVRKG--PVDLGIWNF--ISPSELYIPLDVHVGRISRQTGLLTRKANDFKSVIELTENLKK 224 Clostridium sp....
CCZ50903     151 IPNPANGGAMKRMNMYLRWMVRSS--EVDLGIWKF--MQPKDLLIPLDVHVARVSRSMGLLNRKSNDFKAVLELTEKLRE 226 Acinetobacter s...
ABZ94384     170 IGKWKSKSPKKRISLFLRWMVRND--YPDFGLYQN--IKPNQIPYPMDVHIQKLIKVLGIKNQKQIQLNDAFLLTEFFKK 245 Leptospira bifl...
WP_013450498 171 FPDPES-SGLKRFRMFLRWMIRKD--EIDFGLWKN--FDRKDLIYPIDTHILRFADKNGIVSNETNSLKNALKITEFFRG 245 Calditerrivibri...
CDB10907     147 LGSPSRNSACKRINMLLRWMVRKD--DIDLGLWQTdlITPATLYAILDTHVAQQATRMGLISYPKESWKAVLELTDVYRS 224 Bacteroides sp....
WP_013886051 165 FPK-YGKSGLKRLRMFLRWMVRKD--DVDFGLWGA--YKTGELLYPPDTHILRFAKNFGIISSEANSHRNARLITDYFKT 239 Flexistipes sin...
WP_013007882 141 LPDITKSSA-KRVRMFFRWMVRKD--NIDFGVWVK--YDKKSLKFPLDIHILTYAYNRNIIRNKSNSYKNTLKVTDYFLK 215 Deferribacter d...
CCY23565     152 IPDPKKGGAMKRMCMYLRWMVRKG--PVDFGIWDF--MPASELLIPLDVHVARISREMGLLTRNANDFKAVLELTENLKK 227 Brachyspira sp....
CDE59577     152 IPDARKGSAMKRMCMYLRWMVRKG--PVDFGIWNF--MKPSELLIPLDTHVARLSREMGLLTRNANDFKSVLEITENLRK 227 Fusobacterium s...
Q73Q40       234 FCPEDPAKYDFALFAPEVE 252 Treponema denticola
CDE98072     225 FCPNDPVKYDFAMFGYGVN 243 Clostridium sp. CAG:813
CCZ50903     227 FCPEDPVKYDFAMFAFGVE 245 Acinetobacter sp. CAG:196
ABZ94384     246 INSNDPLLYDFYLTRVGIi 264 Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
WP_013450498 246 INSSDPLKYDFTITRLGMi 264 Calditerrivibrio nitroreducens
CDB10907     225 WDSKDPIKYDFVLmtnnlq 243 Bacteroides sp. CAG:633
WP_013886051 240 IDKQDPVKYDFAITRLGMl 258 Flexistipes sinusarabici
WP_013007882 216 INEIDPVKYDFALTRLGMi 234 Deferribacter desulfuricans
CCY23565     228 FDSADPAKYDFAMFGYGVN 246 Brachyspira sp. CAG:484
CDE59577     228 FDPEDPTKYDFALFGYGVN 246 Fusobacterium sp. CAG:439
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap