Conserved Protein Domain Family
RE_Alw26IDE

?
pfam09665: RE_Alw26IDE 
Type II restriction endonuclease (RE_Alw26IDE)
Members of this entry are type II restriction endonucleases of the Alw26I/Eco31I/Esp3I family. characterized specificities of the three members are GGTCTC, CGTCTC and the shared subsequence GTCTC.
Statistics
?
PSSM-Id: 286713
View PSSM: pfam09665
Aligned: 2 rows
Threshold Bit Score: 1109.78
Threshold Setting Gi: 122381545
Created: 27-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1ATV9  11 HPRFLEYQKFIVEHPNYAGMPDVRGVSGDIQWEAPSNRKSGRFRDTYRKRDAWWAEKAREVGIDPSSNQWISRTAKKIHP 90  Rubrobacter xylanophi...
Q1ATV9  11 HPRFLEYQKFIVEHPNYAGMPDVRGVSGDIQWEAPSNRKSGRFRDTYRKRDAWWAEKAREVGIDPSSNQWISRTAKKIHP 90  Rubrobacter xylanophi...
Q1ATV9  91 TGEKPCKVCGRVLDIAYAYPNRHLIGRLQRLPYVDESFPIDPLEHISSLVTRMVEQFGDSVFEELPALLGTKWISVPELE 170 Rubrobacter xylanophi...
Q1ATV9  91 TGEKPCKVCGRVLDIAYAYPNRHLIGRLQRLPYVDESFPIDPLEHISSLVTRMVEQFGDSVFEELPALLGTKWISVPELE 170 Rubrobacter xylanophi...
Q1ATV9 171 PRLEVWLKWIAEEYIPHEPSVLSPGVMSNAPDRLDGFHSFNICCRGIRDKGRSKENLQSYTTDRRVFEYWVDGDWVAADR 250 Rubrobacter xylanophi...
Q1ATV9 171 PRLEVWLKWIAEEYIPHEPSVLSPGVMSNAPDRLDGFHSFNICCRGIRDKGRSKENLQSYTTDRRVFEYWVDGDWVAADR 250 Rubrobacter xylanophi...
Q1ATV9 251 LMGIIRSDDELKREPCLNGHPGPCSADHIGPISLGFAHRPEFQFLCKACNSGKNNRMYASDVEHLRRKSDEGETVASWYS 330 Rubrobacter xylanophi...
Q1ATV9 251 LMGIIRSDDELKREPCLNGHPGPCSADHIGPISLGFAHRPEFQFLCKACNSGKNNRMYASDVEHLRRKSDEGETVASWYS 330 Rubrobacter xylanophi...
Q1ATV9 331 QKLWELRRDSVVDEETARRLSKLLRDNRHTAMHVLDRFRRSGHHTFLATFLGLHHANHDISFEGLRVEDHRTRFDNIRKS 410 Rubrobacter xylanophi...
Q1ATV9 331 QKLWELRRDSVVDEETARRLSKLLRDNRHTAMHVLDRFRRSGHHTFLATFLGLHHANHDISFEGLRVEDHRTRFDNIRKS 410 Rubrobacter xylanophi...
Q1ATV9 411 TRTTEYATEQKARRIRVAFSALRDYVDKESRNALNVCTPAIDEKIAEALSLLDGEPLDIRKLDDKIRSIVEQEVPSEEEL 490 Rubrobacter xylanophi...
Q1ATV9 411 TRTTEYATEQKARRIRVAFSALRDYVDKESRNALNVCTPAIDEKIAEALSLLDGEPLDIRKLDDKIRSIVEQEVPSEEEL 490 Rubrobacter xylanophi...
Q1ATV9 491 RSVVTRIPTPEEEPDTFRDARARLREAMDLVAAEFS 526 Rubrobacter xylanophilus DSM 9941
Q1ATV9 491 RSVVTRIPTPEEEPDTFRDARARLREAMDLVAAEFS 526 Rubrobacter xylanophilus DSM 9941
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap