Conserved Protein Domain Family
Alph_Pro_TM

?
pfam09608: Alph_Pro_TM 
Putative transmembrane protein (Alph_Pro_TM)
This family consists of predicted transmembrane proteins of about 270 amino acids. Members are found, so far, only among the Alphaproteobacteria and only once in each genome.
Statistics
?
PSSM-Id: 337457
View PSSM: pfam09608
Aligned: 71 rows
Threshold Bit Score: 186.215
Threshold Setting Gi: 503716593
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2RNG8        96 PLVADLSKHLVAITTAFSGTDVLLFGATDG--P--------GDVVMVVRGPRDSHVVRRKDKLGIIWANQESVVFDEVPT 165 Rhodospirillum ...
Q5LXF2        32 QVVLGLSRDRVAITADFDGSDILIFGAIKR--EtpipdgdpLQVIVAVSGPSAPVLVRRKEKKLGIWVNTDSVLVDSAPS 109 Ruegeria pomeroyi
Q169S5        25 EVVLGLSKDRISINTNFDGSEILIFGAIKR--EelipdgppIQVIVTVAGPSLPITVRRKEKKLGIWVNTDAVDVDAAPS 102 Roseobacter den...
WP_015501451  19 EIVLGLSRDEVAITANFNGSEVMIFGAIKR--DapapeggpLEVIITLAGPLEPVLVRRKERILGIWVNTDAVEVDAAPS 96  Octadecabacter ...
WP_037234262  36 iIEAGAAQNQFYIEPSYDGTSIVLFGAVDR--Drlk--gepFDIAVTLRGPVQPVVVWKKDRRAGLWVNSQRLIFDGVPN 111 Rhodomicrobium ...
WP_013068935  20 RVVAGISADNIGITAAFDGSSVLIFGAVKRdaPepe---gqLGVIVTLEGPQQKVTVRRKTREMGIWVNSDKMVISSVPS 96  Rhodobacter cap...
WP_015826769  34 ELSAALSESKIKVDVDFSGTRITLFAVSDQ--Wdn----psVTFAVALVGPQRPYTITHHTKN-----NKERFVFVSAPA 102 Hirschia baltica
WP_011749008  32 QIVAGLSRDDVDITTSFDGSEIIIYGAIKR--EtripqghpLDVIVAVEGPAQTLTVRHKERRLGIWINTGRVSIGSAPS 109 Paracoccus deni...
WP_020951964  44 QVVAGLSHKDVNITTNFDGSDIIIYGAIKR--EtpipfgppLDVIVTVEGPAQSLTIRKKERHLGLWINTESVRIGAAPG 121 Paracoccus amin...
AFO90126      63 EVVLGLSQDRVAITANFDGSEILIFGAVKR--EapipqddpLEVIVAVSGPSSPVMVRRKEKKLGIWVNTDSVLVDSAPS 140 Phaeobacter gal...
Q2RNG8       166 FYRVASNRPLESFTTPAVLSRHQI--GTAYLALPVrdaDFYDAP---TRAVFRDAFLRLKRQQGLYGGMGEdsaapgddR 240 Rhodospirillum ...
Q5LXF2       110 FYAAATSAPFSQALSDTEDLRHRV--SIRRAIRSVg--ADMNIA---DAQEFTRAVMRIRQNEGLYSIREN--------T 174 Ruegeria pomeroyi
Q169S5       103 FYAVLSSGPLREVLKEVEDLRHKV--SVPRAIRSVg--APQDIQ---DSASFTEALIRIRENGDVYQLREG--------S 167 Roseobacter den...
WP_015501451  97 FYAVATSSPMRDVLTSVEDLRYGI--SIPRVIRSVg--aPDTVQ---NSETFTEALIRIRAGSQLYQILDS--------E 161 Octadecabacter ...
WP_037234262 112 YFAVLSTRPLDDIAPLAERDRYEL--GIDVLSLPIr-dEQKNAPsklDRSEFEAALVRQKKAAGLFVEEAR--------A 180 Rhodomicrobium ...
WP_013068935  97 FYAVASSAPLDRILSPETDAAERI--SVPVAVE-Ay-aGPLGRS---DGRPFAEALLRLREGTGAYSVSER--------A 161 Rhodobacter cap...
WP_015826769 103 ILSVATEAGKDDIETAKELNLAIInpRYSAM---Pe-pDNMNDP---KLEYWRQAFADLKTQKGLFNTNTH--------G 167 Hirschia baltica
WP_011749008 110 FYAVATTRPLHLILPPAEDQRYRV--SIPLAMRAFa--GPMEVE---DAVPYTAALIRLRQANGLYRQDDG--------T 174 Paracoccus deni...
WP_020951964 122 FYVVATTGPLDKILTPEQDASYRI--SIPRAIRAFa--GPITVS---DTVPFTEALVRLREESDAYRLDEG--------A 186 Paracoccus amin...
AFO90126     141 FYAVATSAPLSQVLSDTEDLRYRV--SVGRAIRSVg--AGMHIR---GAQRFAEAVIRIRSDNDLYSLREN--------T 205 Phaeobacter gal...
Q2RNG8       241 IALLDNRLFRANLYFPANVPVGSYIVEVYLFRDGEVVSAEITPLVISKIGIGAEIFDFAKHRALAYGVAAVIVAIAAGWL 320 Rhodospirillum ...
Q5LXF2       175 VAVDEQTLFRTEIDMPANLTEGEYIARIFLTRGGRVVSSFQTTIDVRKVGLERFLFNLAHQQPVLYGLMSLAIAIAAGWG 254 Ruegeria pomeroyi
Q169S5       168 VEIEEQTLFRTSVRLPAALTEGDYVTRIFLTRGGDVVSSYETTIDVQKVGMERWLFELSRQQPLIYGLMSLAIAIAAGWG 247 Roseobacter den...
WP_015501451 162 VDIEEETLFRGQITLPAALTEGEYTAHIYITRDGVVIDDYVTGIAVYKAGLERWLYEMSRNQPFLYGLMSLAIAISAGWL 241 Octadecabacter ...
WP_037234262 181 IDFFGVSLFRTKTFLPAAAGPGLYVAHFYVLQGGKVIGDATARIRLRKIGIEARLSSTASEHPWLYGVIAVALAAFVGGA 260 Rhodomicrobium ...
WP_013068935 162 VTLAADTLFRADFDLPANLIEGDYTARMYLLREGKVIDQTHASIKVRRIGLERFTYALSREQPllygllslglaifagwa 241 Rhodobacter cap...
WP_015826769 168 LQRLDGGLIRADIDLPAAAPPGMYDVRILLFQDDTLLAETQTPLLLERKGVENALFTLSLKHPIIYGFLAVLLGCSVGIG 247 Hirschia baltica
WP_011749008 175 VRLAEQTLFRADVRLPANLVEGFYSTRIFLLRDGQVIDTFRAPIEVRKVGLERWLYRLALEQPFIYGIMSLAIAVAAGWA 254 Paracoccus deni...
WP_020951964 187 VTVVEQTLFRADVKMPANLIEGDYSTRIFLLRNGEVIDTYRAPIEVRKVGLERWLYHLAMAQPFLYGLMSLAIAIAAGWA 266 Paracoccus amin...
AFO90126     206 VAVDQQTLFRTAIDMPADLTEGAYRTRILLTRGGTVVAQYETNIDVRKVGLERFLYAMSREQPFLYGLMSLAIAIAAGWG 285 Phaeobacter gal...
Q2RNG8       321 AGVAFRK 327 Rhodospirillum rubrum ATCC 11170
Q5LXF2       255 ASAAFRA 261 Ruegeria pomeroyi
Q169S5       248 AAAVFKl 254 Roseobacter denitrificans OCh 114
WP_015501451 242 ASAAFRi 248 Octadecabacter antarcticus
WP_037234262 261 TSFLTRR 267 Rhodomicrobium udaipurense
WP_013068935 242 aaaafrl 248 Rhodobacter capsulatus
WP_015826769 248 AAFLggg 254 Hirschia baltica
WP_011749008 255 ASAAFRl 261 Paracoccus denitrificans
WP_020951964 267 ASVAFRA 273 Paracoccus aminophilus
AFO90126     286 ASAAFRl 292 Phaeobacter gallaeciensis DSM 17395 = CIP 105210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap