Conserved Protein Domain Family
HrpB7

?
pfam09486: HrpB7 
Bacterial type III secretion protein (HrpB7)
This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia.
Statistics
?
Aligned: 8 rows
Threshold Bit Score: 81.7211
Threshold Setting Gi: 120587621
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBW77102        6 RRITALRRAVIRRKRIEDELREMLAQQRDEQATLLHSCEDKGTQIERERDVVRANEERIAQMMTGSSCFSIAEMQASMRY 85  Paraburkholder...
WP_011205606    5 RRAMAFARALERRRRLDAVLREELAERRTRLQSLDRVLKEKVSQVELKADDVHRHAARIDTLMTGTASFSLDELTACRAY 84  Burkholderia
ACR30714       11 RRAIALNRASERRRKQNDALRAQLVAQRAALAQREADLAVAHEQVERDLAAVQSINDQLDAMTTGAAPFVLDDFSACRIV 90  Burkholderia g...
Q63JT6          4 RQQRAFETLLARRAQRGERLRAEQRVLRAERDAAAAELAQGEAHAHAKRDAANRYAERVDAMAAGRAPFTIGDYAACRRY 83  Burkholderia p...
jgi:Aave_0454   8 R------TLVRLKARRTEQAEAALQESIQALKGEEEALAQAQAEESHARDAERARRERLASATSAGSCFLANDAITLQML 81  Acidovorax cit...
Q8PB86          3 ERVSTWRTLQQLKTRRYQRMQDHLSDCRRALEQCDGERASCSQQADACTTRLAAFDAALADTAGAGEPIGIEAILQHQRF 82  Xanthomonas ca...
Q8XRH6          5 RRSSVWRALIEAKTRERRRVEADIEAAQAALAEAQTAVEARQDALRQAEQRLDDHLRSMDDLTTGPS-LTAQAYLQYDAY 83  Ralstonia sola...
nioo:CFU_4335   4 daAKIWRAIVAAQMRRQQRAKDELEAARQDMLAAEAAHAAAAAETAQACERSRIHEDGLKELLAAS--LSAALYLSHDAW 81  Collimonas fun...
CBW77102       86 MDLVTDRIRVLQRELAALEQQYREKTDEISRTAQAIASNRGRIDVCERRIGVLRRKLDELASDIADEEAEEAALARA 162 Paraburkholderia ...
WP_011205606   85 LDVAVAHLRALESEEARLRAEFDALAAAIEEKKLEIGRNLSRIDACDARIEQIRRHGERAADEALDEEMEEAALGAR 161 Burkholderia
ACR30714       91 LGIASERLHASEAQLEAARQAVDDAAAAIAGTNRTIARNLGSVDACQQRIAAMRRGYQRAEDDAADDEAEDGVLARR 167 Burkholderia glum...
Q63JT6         84 RDALLDEHALASAQCARLRAALQAKVDRLAATARRIARNDAQIDVVRERIRRLARAAEAAAEDAHDEEIEEGVLARR 160 Burkholderia pseu...
jgi:Aave_0454  82 VSEAQGQSTEAERHTAQARDRVDAAREQVRLRDAAVRRAQRQLEATRERLEQALAAAERAQEDAQDEEAEETAVARm 158 Acidovorax citrul...
Q8PB86         83 RAVLEERCGAAEQALVAATQALQRAHDEVATVQQTVSRLEAQAQVYAEKAARARRAWQAQREAAEEEDAIEALIGLR 159 Xanthomonas campe...
Q8XRH6         84 RTQLEGGVGQAEQAVAAAQGVVAEREAALQAQRRKLARLDAMLERCRETADRLDRKEDAERELATEEEAVEAILARA 160 Ralstonia solanac...
nioo:CFU_4335  82 RGHLRGEVQVMQARERQAHDTLEKQERKVAIVRTKLVRMDAALDKCRLKLKRIEDDTRRRREENADEEAIESLLARR 158 Collimonas fungiv...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap