2DLB


Conserved Protein Domain Family
Yopt

?
pfam09467: Yopt 
Click on image for an interactive view with Cn3D
Hypothetical protein Yopt
This hypothetical protein is expressed in bacteria, particularly Bacillus subtilis. It forms homo-dimers, with each monomer consisting of one alpha helix and three beta strands.
Statistics
?
Aligned: 3 rows
Threshold Bit Score: 127.915
Threshold Setting Gi: 81342333
Created: 21-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2DLB_A  2 AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDXEYEITNTEELPE 72  Bacillus subtilis
O34498  2 AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELPE 72  Bacillus subtilis subsp. subtil...
O34498  2 AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELPE 72  Bacillus subtilis subsp. subtil...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap