2DLB,2DLB


Conserved Protein Domain Family
Yopt

?
pfam09467: Yopt 
Click on image for an interactive view with Cn3D
Hypothetical protein Yopt
This hypothetical protein is expressed in bacteria, particularly Bacillus subtilis. It forms homo-dimers, with each monomer consisting of one alpha helix and three beta strands.
Statistics
?
PSSM-Id: 286543
View PSSM: pfam09467
Aligned: 2 rows
Threshold Bit Score: 134.859
Threshold Setting Gi: 99032096
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                  10        20        30        40        50        60        70
          ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
2DLB_A  2 AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDXEYEITNTEELPE 72
2DLB_A  2 AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDXEYEITNTEELPE 72
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap