2FH5,1NRJ


Conserved Protein Domain Family
SRPRB

?
pfam09439: SRPRB 
Click on image for an interactive view with Cn3D
Signal recognition particle receptor beta subunit
The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase which anchors the alpha subunit to the endoplasmic reticulum membrane.
Statistics
?
PSSM-Id: 312813
View PSSM: pfam09439
Aligned: 10 rows
Threshold Bit Score: 221.919
Threshold Setting Gi: 549728
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FH5_B        5 SSQRAVLFVGLCDSGKTLLFVRLLTG-----QYRDTQTSItDSSAIYKVnn---nRGNSLTLIDLPGHESLRFQLLDR-- 74
gi 74610477  42 KKVPTIIIAGPSYSGKTSLFHKLTSDet--nAKLLTVMSQ-EPSFALKY------KGTMTTLADYPGHVKLAYKLKNGii 112
gi 549728    36 SYQPSIIIAGPQNSGKTSLLTLLTTD-----SVRPTVVSQ-EPLSAADY------DGSGVTLVDFPGHVKLRYKLSDYlk 103
gi 74694940  42 TSSPIFIIAGPSGSGKTSLFNLLTTG-----EAGKTVASQ-IASFSDSFmlpsgvEKFKFALIDFPGHVKLRQELFTTlk 115
gi 74965772  36 SNKNRVLFVGLMDCGKTTIFTQLSQKeaeypTTTKTYTSMvENKITLRI------KDKEKEIIDYPGNDRLRQKLIENhl 109
gi 31340540  62 SSQRAVLLVGLCDSGKTLLFVRLLTG-----LYRDTQTSItDSCAVYRVnn---nRGNSLTLIDLPGHESLRLQFLER-- 131
gi 74605845  39 NRAPTFIIAGLPQTGKTALFNLLTTD-----SVKPSVMSQ-EPNVAEDYmlptshKNFKFKLIDFPGHDKFRSELLQTik 112
gi 50540210  58 KVRNAVLLLGLCDSGKTLLFTRLLLG-----KFVRTQTSItESSATYKSks---eRGNSWTLIDVPGHESLRTQIVEk-- 127
1NRJ_B       10 SYQPSIIIAGPQNSGKTSLLTLLTTD-----SVRPTVVSQ-EPLSAADY------DGSGVTLVDFPGHVKLRYKLSDYlk 77
gi 63101946  58 kVRNAVLLLGLCDSGKTLLFTRLLLG-----KFVRTQTSItESSATYKSks---eRGSSWTLIDVPGHESLRTQIVEK-- 127
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2FH5_B       75 FKSS-ARAVVFVVDSAAFQREVKDVAEFLYQVLIDSMAL-KNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRS 152
gi 74610477 113 DLKGnLKGILFVLDSTIDPKNITETAEYLTEILLILEKI-REPIDILIACNKNESFTARQPLKIKEALENEITRIFERKK 191
gi 549728   104 TRAKfVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESScENGIDILIACNKSELFTARPPSKIKDALESEIQKVIERRK 183
gi 74694940 116 ASSN-IRGLIFMVDSTVDPKRVTETAEFLYDVLSITERK-PQAIDIMIACNKSESFTSRPPTMIKDALEKELGQIIERKS 193
gi 74965772 110 HSRS-LLRIVFVVDSAAFSKNARDVAELFYTVALENV----DKVPILIACHKQDLSLAKTEKVIRNSLEKEIGLINKSRA 184
gi 31340540 132 FKSS-ARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGL-KNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRS 209
gi 74605845 113 DSSQ-LKGLIYVIDSTINPKELVSTAELLYEILSVTELR-PDGVDILLACNKSESFVARPPSKIKGALEKEITEIMKRKA 190
gi 50540210 128 YKDV-ARAIVFVVDSSIFQKDVRDVAEFLYSILTDSILA-KNAPTLVVACNKQDITMAKSAKLIQQQLEKELNTLRLTRS 205
1NRJ_B       78 TRAKfVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESScENGIDILIACNKSELFTARPPSKIKDALESEIQKVIERRK 157
gi 63101946 128 YKDV-ARAIVFVVDSSTFQKDVRDVAEFLYSILTDSILA-KNAPTLVVACNKQDITMAKSAKLIQQQLEKELNTLRLTRS 205
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*....
2FH5_B      153 AAPSTL----------D---SSST---APAQLgkkGKEFEFSQLPLK-V 184
gi 74610477 192 KSLGNIerdigdvdeiN---ENLD---LSFDI---SKGFKFDYLEGN-V 230
gi 549728   184 KSLNEVerkineedyaE---NTLD-------VlqsTDGFKFANLEAS-V 221
gi 74694940 194 KDLKGA--------------GEDD---LTTVFatsGSAFKLDHLEAA-V 224
gi 74965772 185 AALIGT----------D---GSEE---KRSTLtdtGIDFKWEDLKKQeV 217
gi 31340540 210 AAPSTL----------D---SSST---APAQLgkkGKEFEFSQLPLK-V 241
gi 74605845 191 KSLKANskkslsddanD---DDDD---EVAVLqqnSAGFEFDRIDGN-V 232
gi 50540210 206 AALSSQ----------D---GAVG---GSVYLgkkGKDFEFSQLANR-V 237
1NRJ_B      158 KSLNEV----------ErkiNEEDyaeNTLDVlqsTDGFKFANLEAS-V 195
gi 63101946 206 AALSSQ----------D---GAVG---GSVYLgkkGKDFEFSQLANR-V 237
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap