2FH5,1NRJ


Conserved Protein Domain Family
SRPRB

?
pfam09439: SRPRB 
Click on image for an interactive view with Cn3D
Signal recognition particle receptor beta subunit
The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase which anchors the alpha subunit to the endoplasmic reticulum membrane.
Statistics
?
PSSM-Id: 312813
View PSSM: pfam09439
Aligned: 10 rows
Threshold Bit Score: 221.919
Threshold Setting Gi: 549728
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FH5_B         5 SSQRAVLFVGLCDSGKTLLFVRLLTG-----QYRDTQTSItDSSAIYKVnn---nRGNSLTLIDLPGHESLRFQLLDR-- 74  house mouse
Q6FUX9        42 KKVPTIIIAGPSYSGKTSLFHKLTSDet--nAKLLTVMSQ-EPSFALKY------KGTMTTLADYPGHVKLAYKLKNGii 112 Candida glabrata
P36057        36 SYQPSIIIAGPQNSGKTSLLTLLTTD-----SVRPTVVSQ-EPLSAADY------DGSGVTLVDFPGHVKLRYKLSDYlk 103 Saccharomyces c...
Q75C54        42 TSSPIFIIAGPSGSGKTSLFNLLTTG-----EAGKTVASQ-IASFSDSFmlpsgvEKFKFALIDFPGHVKLRQELFTTlk 115 Eremothecium go...
Q22013        36 SNKNRVLFVGLMDCGKTTIFTQLSQKeaeypTTTKTYTSMvENKITLRI------KDKEKEIIDYPGNDRLRQKLIENhl 109 Caenorhabditis ...
Q9Y5M8        62 SSQRAVLLVGLCDSGKTLLFVRLLTG-----LYRDTQTSItDSCAVYRVnn---nRGNSLTLIDLPGHESLRLQFLER-- 131 human
Q6CNK9        39 NRAPTFIIAGLPQTGKTALFNLLTTD-----SVKPSVMSQ-EPNVAEDYmlptshKNFKFKLIDFPGHDKFRSELLQTik 112 Kluyveromyces l...
NP_001002572  58 KVRNAVLLLGLCDSGKTLLFTRLLLG-----KFVRTQTSItESSATYKSks---eRGNSWTLIDVPGHESLRTQIVEk-- 127 zebrafish
1NRJ_B        10 SYQPSIIIAGPQNSGKTSLLTLLTTD-----SVRPTVVSQ-EPLSAADY------DGSGVTLVDFPGHVKLRYKLSDYlk 77  baker's yeast
AAH95560      58 kVRNAVLLLGLCDSGKTLLFTRLLLG-----KFVRTQTSItESSATYKSks---eRGSSWTLIDVPGHESLRTQIVEK-- 127 zebrafish
2FH5_B        75 FKSS-ARAVVFVVDSAAFQREVKDVAEFLYQVLIDSMAL-KNSPSLLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRS 152 house mouse
Q6FUX9       113 DLKGnLKGILFVLDSTIDPKNITETAEYLTEILLILEKI-REPIDILIACNKNESFTARQPLKIKEALENEITRIFERKK 191 Candida glabrata
P36057       104 TRAKfVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESScENGIDILIACNKSELFTARPPSKIKDALESEIQKVIERRK 183 Saccharomyces c...
Q75C54       116 ASSN-IRGLIFMVDSTVDPKRVTETAEFLYDVLSITERK-PQAIDIMIACNKSESFTSRPPTMIKDALEKELGQIIERKS 193 Eremothecium go...
Q22013       110 HSRS-LLRIVFVVDSAAFSKNARDVAELFYTVALENV----DKVPILIACHKQDLSLAKTEKVIRNSLEKEIGLINKSRA 184 Caenorhabditis ...
Q9Y5M8       132 FKSS-ARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGL-KNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRS 209 human
Q6CNK9       113 DSSQ-LKGLIYVIDSTINPKELVSTAELLYEILSVTELR-PDGVDILLACNKSESFVARPPSKIKGALEKEITEIMKRKA 190 Kluyveromyces l...
NP_001002572 128 YKDV-ARAIVFVVDSSIFQKDVRDVAEFLYSILTDSILA-KNAPTLVVACNKQDITMAKSAKLIQQQLEKELNTLRLTRS 205 zebrafish
1NRJ_B        78 TRAKfVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESScENGIDILIACNKSELFTARPPSKIKDALESEIQKVIERRK 157 baker's yeast
AAH95560     128 YKDV-ARAIVFVVDSSTFQKDVRDVAEFLYSILTDSILA-KNAPTLVVACNKQDITMAKSAKLIQQQLEKELNTLRLTRS 205 zebrafish
2FH5_B       153 AAPSTL----------D---SSST---APAQLgkkGKEFEFSQLPLK-V 184 house mouse
Q6FUX9       192 KSLGNIerdigdvdeiN---ENLD---LSFDI---SKGFKFDYLEGN-V 230 Candida glabrata
P36057       184 KSLNEVerkineedyaE---NTLD-------VlqsTDGFKFANLEAS-V 221 Saccharomyces cerevisiae S288c
Q75C54       194 KDLKGA--------------GEDD---LTTVFatsGSAFKLDHLEAA-V 224 Eremothecium gossypii
Q22013       185 AALIGT----------D---GSEE---KRSTLtdtGIDFKWEDLKKQeV 217 Caenorhabditis elegans
Q9Y5M8       210 AAPSTL----------D---SSST---APAQLgkkGKEFEFSQLPLK-V 241 human
Q6CNK9       191 KSLKANskkslsddanD---DDDD---EVAVLqqnSAGFEFDRIDGN-V 232 Kluyveromyces lactis
NP_001002572 206 AALSSQ----------D---GAVG---GSVYLgkkGKDFEFSQLANR-V 237 zebrafish
1NRJ_B       158 KSLNEV----------ErkiNEEDyaeNTLDVlqsTDGFKFANLEAS-V 195 baker's yeast
AAH95560     206 AALSSQ----------D---GAVG---GSVYLgkkGKDFEFSQLANR-V 237 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap