3R24


Conserved Protein Domain Family
NSP10

?
pfam09401: NSP10 
Click on image for an interactive view with Cn3D
RNA synthesis protein NSP10
Non-structural protein 10 (NSP10) is involved in RNA synthesis. it is synthesized as a polyprotein whose cleavage generates many non-structural proteins. NSP10 contains two zinc binding motifs and forms two anti-parallel helices which are stacked against an irregular beta sheet. A cluster of basic residues on the protein surface suggests a nucleic acid-binding function.
Statistics
?
PSSM-Id: 286486
View PSSM: pfam09401
Aligned: 7 rows
Threshold Bit Score: 207.69
Threshold Setting Gi: 354459559
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3R24_B         15 TVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHP----NPK 90  
P0C6V0       4329 AILSLCAFSVDPKKTYLDYIKQGGVPVTNCVKMLCDHAGTGMAITIKPEATTNQDSYGGASVCIYCRSRVEHP----DVD 4404 Murine hepati...
Q98VG9       3900 GLLTLCAFAPDPAKAYVDAVKRGMQPVTNCVKMLSNGAGNGMAITNGVESNTQQDSYGGASVCIYCRCHVEHP----AID 3975 Feline infect...
P0C6U2       3945 HLLTHCSFAVDPAAAYLDAVKQGAKPVGNCVKMLTNGSGSGQAITCTIDSNTTQDTYGGASVCIYCRAHVAHP----TMD 4020 Human coronav...
P0C6U8       4242 TVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHP----NPK 4317 Severe acute ...
YP_002308496 3478 SLLTYLAFAVNPKEAYLKHLADGGNPIRGCIQMIAS-LGPGFAVTTKPQPNEHQYSYGGASICLYCRAHIPHP----GAD 3552 Thrush corona...
P0C6V3       3796 GILSLCSFAVDPADTYCKYVAAGNQPLGNCVKMLTVHNGSGFAITSKPSPTPDQDSYGGASVCLYCRAHIAHPgsvgNLD 3875 Avian infecti...
3R24_B         91 GFCDLKGKYVQIPTTcANDPVGFTLRNTVCTVCGMWKGYGCSCD 134 
P0C6V0       4405 GLCKLRGKFVQVPLG-IKDPVSYVLTHDVCQVCGFWRDGSCSCV 4447 Murine hepatitis virus strain A59
Q98VG9       3976 GLCRFKGKFVQVPTG-TQDPIRFCIENEVCVVCGCWLTNGCMCD 4018 Feline infectious peritonitis virus (strain 79-1146)
P0C6U2       4021 GFCQYKGKWVQVPIG-TNDPIRFCLENTVCKVCGCWLNHGCTCD 4063 Human coronavirus 229E
P0C6U8       4318 GFCDLKGKYVQIPTTcANDPVGFTLRNTVCTVCGMWKGYGCSCD 4361 Severe acute respiratory syndrome-related coronav...
YP_002308496 3553 GRCLYKGRFVQIDKD--KEPISFALTHEPCNACQHWVNYDCTCG 3594 Thrush coronavirus HKU12-600
P0C6V3       3876 GRCQFKGSFVQIPTT-EKDPVGFCLRNKVCTVCQCWIGYGCQCD 3918 Avian infectious bronchitis virus (strain Beaudette)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap