2G9T


Conserved Protein Domain Family
NSP10

?
pfam09401: NSP10 
Click on image for an interactive view with Cn3D
RNA synthesis protein NSP10
Non-structural protein 10 (NSP10) is involved in RNA synthesis. it is synthesized as a polyprotein whose cleavage generates many non-structural proteins. NSP10 contains two zinc binding motifs and forms two anti-parallel helices which are stacked against an irregular beta sheet. A cluster of basic residues on the protein surface suggests a nucleic acid-binding function.
Statistics
?
PSSM-Id: 286486
View PSSM: pfam09401
Aligned: 6 rows
Threshold Bit Score: 207.305
Threshold Setting Gi: 114793996
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2G9T_I         12 TVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHP----NPK 87
gi 190360145 4329 AILSLCAFSVDPKKTYLDYIKQGGVPVTNCVKMLCDHAGTGMAITIKPEATTNQDSYGGASVCIYCRSRVEHP----DVD 4404
gi 145559519 3900 GLLTLCAFAPDPAKAYVDAVKRGMQPVTNCVKMLSNGAGNGMAITNGVESNTQQDSYGGASVCIYCRCHVEHP----AID 3975
gi 190360137 3945 HLLTHCSFAVDPAAAYLDAVKQGAKPVGNCVKMLTNGSGSGQAITCTIDSNTTQDTYGGASVCIYCRAHVAHP----TMD 4020
gi 190360148 3796 GILSLCSFAVDPADTYCKYVAAGNQPLGNCVKMLTVHNGSGFAITSKPSPTPDQDSYGGASVCLYCRAHIAHPgsvgNLD 3875
gi 212681379 3478 SLLTYLAFAVNPKEAYLKHLADGGNPIRGCIQMIAS-LGPGFAVTTKPQPNEHQYSYGGASICLYCRAHIPHP----GAD 3552
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
2G9T_I         88 GFCDLKGKYVQIPTTcANDPVGFTLRNTVCTVCGMWKGYGCSCD 131
gi 190360145 4405 GLCKLRGKFVQVPLG-IKDPVSYVLTHDVCQVCGFWRDGSCSCV 4447
gi 145559519 3976 GLCRFKGKFVQVPTG-TQDPIRFCIENEVCVVCGCWLTNGCMCD 4018
gi 190360137 4021 GFCQYKGKWVQVPIG-TNDPIRFCLENTVCKVCGCWLNHGCTCD 4063
gi 190360148 3876 GRCQFKGSFVQIPTT-EKDPVGFCLRNKVCTVCQCWIGYGCQCD 3918
gi 212681379 3553 GRCLYKGRFVQIDKD--KEPISFALTHEPCNACQHWVNYDCTCG 3594
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap