1XWI


Conserved Protein Domain Family
Vps4_C

?
pfam09336: Vps4_C 
Click on image for an interactive view with Cn3D
Vps4 C terminal oligomerization domain
This domain is found at the C terminal of ATPase proteins involved in vacuolar sorting. It forms an alpha helix structure and is required for oligomerization.
Statistics
?
PSSM-Id: 337367
View PSSM: pfam09336
Aligned: 147 rows
Threshold Bit Score: 59.8097
Threshold Setting Gi: 514695112
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
1XWI_A       259 LTPCSPG--DPGAIEMTWMDVPGDKLLEP-VVSMSDMLRSLSNTKPTVNEHDLLKLKKFTEDFG 319
gi 124464657 402 YMACSPS--DPEGQQMRMYDIKGGQLYLP-HIEYDDFLSVLPKCRPSVSQGDLKKYEDWTSEFG 462
gi 124468704 370 YTVCSAS--DPQAEKITMKSIEKGQIFVP-EILYDDFLAVLPKCKPSVSKGDLEKYEDWTQQFG 430
gi 124474695 361 YMVCSLN--DPEAEEMTLMDIPSGQLLLNeNISYSDFLAVLPNLKRDITQQQLMEYKNWTDQFG 422
gi 121985977 348 YTPCLQS--DEDAEEINLYQLDPKQIILR-KAEIKDFKESIKNCKPTVSKKFLDYYNKFLEKCG 408
gi 762154682 110 FVPCKED--EDADLKASIVEIPADKVRPR-EVTLNDFLSALKTHRKTVTQEEIQKFENFTKSMG 170
gi 780011558 221 FTPCDES--EPDSVEQSMRDIQ-PELVQPrQITIQDFLKALCTSQGTISQAELHKFTEFTQKFG 281
gi 514695112 362 WRPCDEE--EPGALRGNVQDIPAEDAVAR-SVRSGDVAKAIARNPRTVSSEELARFLAYnqh-- 420
gi 156355133 221 apPCSEG--EPGCVTCLLKDLP-PQKVTPrPVVLEDFIRSLSHNGSTITDEDLDKFTVFTKSYG 281
gi 156100169 353 YTPCSPGdpDATKVEKNVMSLNENELLLP-PLSVQDFKTAISNAKPSLSVDDLKKYEEWTQQYG 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap