4DLP


Conserved Protein Domain Family
tRNA-synt_1g

?
pfam09334: tRNA-synt_1g 
Click on image for an interactive view with Cn3D
tRNA synthetases class I (M)
This family includes methionyl tRNA synthetases.
Statistics
?
Aligned: 24 rows
Threshold Bit Score: 472.551
Threshold Setting Gi: 25009406
Created: 21-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4DLP_A  27 YYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRDLADRNTSAFRRMAEV 106 Brucella abortus 2308
Q90YI3  44 YYITTPIFYVNASPHLGHLYSAVIADCFHRHKQLQGFNSRFATGTDEHGLKIQQAAEAAGKEPLEFCTTVSERFRHLFSS 123 torafugu
Q2YQ76   6 YYITTAIAYPNGKPHIGHAYELIATDAMARFQRLNGMDVYFLTGTDEHGIKMLQSARKEGITPRDLADRNTSAFRRMAEV 85  Brucella abortus 2308
Q9PQU6   7 FFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLFGYDVFFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWKR 86  Ureaplasma parvum ser...
Q5L3W2   6 FYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMRGYDVMYLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKK 85  Geobacillus kaustophilus
Q8EZD6  10 ILVTSALPYANGPIHLGHVLEGIQTDIWVRFQKAIGNECYFFCADDTHGTPVMLAARKEGITPEQLIERVGQEHYRDLTS 89  Leptospira interrogan...
Q8PAY7   5 ALVTTALPYANGPLHLGHLVGYIQADIWVRARRLRGDKTWFVCADDTHGTPIMLAAEKAGVTPEAFIANIQASHERDFAA 84  Xanthomonas campestri...
P43828   8 ILVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNKIHFVCADDAHGTPIMLNADKLGITPEELIAKAKADHIRDFAG 87  Haemophilus influenza...
P57210   8 ILVTCALPYANGSIHIGHMLEHIQADIWVRYHRMRGHEVWFVSADDAHGTAIMLKAQDLEISPNKLIKNIRIEHQIDFSN 87  Buchnera aphidicola s...
Q8D219   7 ILTTCAFPYANGSLHIGHILEHIQADIWVRFNRMIGNEIYFICADDSHGTPIMIKAKKNKISPEKMVFLFYKEHKNDLSK 86  Wigglesworthia glossi...
4DLP_A 107 LNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYAGWYSVRDEAYYGEEE-TE-----V--------RADGVRY-G 171 Brucella abortus 2308
Q90YI3 124 CNISNTDYIRTTEQRHHRAVQHFWSVLCSKGLIYKGSYEGWYSTQDESFLTPSQvtta----------ldsTGKEIKVsL 193 torafugu
Q2YQ76  86 LNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYAGWYSVRDEAYYGEEE-TE-----V--------RADGVRY-G 150 Brucella abortus 2308
Q9PQU6  87 LNISFSKFIRTTQMDHEESVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNPAEiiksqdniMl---------------c 151 Ureaplasma parvum ser...
Q5L3W2  86 LDISYDDFIRTTQERHKKVVEQIFTRLVEQGDIYLGEYEGWYCTPCESFYTERQlVD-----Gnc--------------p 146 Geobacillus kaustophilus
Q8EZD6  90 FGIEYDHYDSTHSKANQEISKDIYLKLKSKGHISRRSIEQSYCETDKMFLPDRF-IK-----GtcpnckskDQYGDNC-E 162 Leptospira interrogan...
Q8PAY7  85 FGVTFDHYDSTNSPVNRELTEAFYTKLEAAGHISRRSVAQFYDPAKGMFLPDRY-IK-----GicpncgsaDQYGDNC-E 157 Xanthomonas campestri...
P43828  88 FNISFDNYHSTHSEENKQLTAEIYNKLKANGFIKSKVISQLFDPEKNMFLPDRF-VK-----GtcpkckaeDQYGDNC-E 160 Haemophilus influenza...
P57210  88 FKISHDNYYSTHSLENLYLSRKIFTCLNEKGLIKEKKIFQLYDTVKKIFLPDRF-IK-----GtcpickskNQYGDNC-E 160 Buchnera aphidicola s...
Q8D219  87 FNISYDNYYLTHSKENYRFCKLIYKLLKRKKLIFSKYISQFYDCKINMFLSDRL-IQ-----GkcpecnseKQYSDNC-N 159 Wigglesworthia glossi...
4DLP_A 172 PQGTPVE----------------WV-EEESYFFRLSAYQDK--------------------LLDLY-ENNPGf-iMPAER 212 Brucella abortus 2308
Q90YI3 194 ESGHKVE----------------WMk-EENYMFRLSGFRSQ--------------------LLDWL-RENPRa-iQPERF 234 torafugu
Q2YQ76 151 PQGTPVE----------------WVe-EESYFFRLSAYQDK--------------------LLDLY-ENNPGfimPAERR 192 Brucella abortus 2308
Q9PQU6 152 RMGHKLE----------------TKs-EESYFYKMSDQAPF--------------------LKTYY-QNHPNfiiPNERA 193 Ureaplasma parvum ser...
Q5L3W2 147 DCGRPVE----------------KVk-EESYFFRMSKYVDR--------------------LLQYY-EENPDfiqPESRK 188 Geobacillus kaustophilus
Q8EZD6 163 VCGATYSpkdlidshcslcgtspVVkNSDHIFFKLGDFHKKdekstsletinpshlktdfdLQSWIeTSGVVs--ESEGV 240 Leptospira interrogan...
Q8PAY7 158 VCGATYAptelkepksvisgatpELrDSEHFFFEVGHFDGF--------------------LREWLdGDV-----ALPGV 212 Xanthomonas campestri...
P43828 161 VCASTYSpmdlinprsavsgttpIVkESEHFFFDLPAFEGM--------------------LKEWTrSGS-----LQSEI 215 Haemophilus influenza...
P57210 161 ICSATYEptdlinpisvisgkkpILkNTKHLYFDLPSFTNM--------------------LKKWIhSGV-----LEESV 215 Buchnera aphidicola s...
Q8D219 160 ICGANYCstdvinpisilsksvpIIkKSKHLFFDLPKFEKF--------------------LKKWIhSGV-----LKKEN 214 Wigglesworthia glossi...
4DLP_A 213 RNEIVSFV--KSGLKDLSIS---RtTFDW-GIPVPGDEKHVMYVWVDALTNYITALGYP----DTTDE-RW-AYWp-AN- 278 Brucella abortus 2308
Q90YI3 235 HHSVLQWL--QEELPDLSVSrqkS-RLQW-GIPVPEDDGQTIYVWLDALVNYLTVVGY--------PN-NHeRWWnvA-- 299 torafugu
Q2YQ76 193 NEIV-SFV--KSGLKDLSISr--T-TFDW-GIPVPGDEKHVMYVWVDALTNYITALGYPd----TTDE-RWa-YWpaN-- 257 Brucella abortus 2308
Q9PQU6 194 NEMVNNFL--NN-LEDLSISr--T-TFDW-GIPIAENPKHVIYVWLDALMNYLTATGYLs----NNEE-LFqKYWcdNet 261 Ureaplasma parvum ser...
Q5L3W2 189 NEMINNFI--KPGLEDLAVSr--T-TFDW-GIKVPGNPKHVIYVWIDALANYITALGYGt----DNDE-KFrKYWpaD-- 255 Geobacillus kaustophilus
Q8EZD6 241 KKKLKEWF--DAGLQDWDIS---R-DGPYfGFEIPDETNKYFYVWLDAPIGYMASSKNFfeknFPNEPnKFdSFW--KNk 312 Leptospira interrogan...
Q8PAY7 213 KAKLKEWLdaEGGLRAWDIS---R-DAPYfGFQIPGQPGKYFYVWLDAPIGYLCSFKTLcaqmG---E-DFqAHLa-AGt 283 Xanthomonas campestri...
P43828 216 ANKMQEWF--ESDLQQWDIS---R-DAPYfGFEIPGAKDKFFYVWLDAPIGYMASFKNLcnreGi----DFnEFWa-EGs 284 Haemophilus influenza...
P57210 216 IKKTEEWF--KVGLKSWAIS---R-DAPYfGFKIPNYPNKYFYVWLDAPIGYISAFKNLcfksK---KlNFnELWn-QNs 285 Buchnera aphidicola s...
Q8D219 215 LRKVSEWF--KNGLKPWDIS---R-DAPYfGFKIPNEKEKYFYVWLDAPIGYLSTFKNLcdkkE---KiFFsEFWd-VNs 284 Wigglesworthia glossi...
4DLP_A 279 ----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVER-YGLDQLRYFLMR-EV 352 Brucella abortus 2308
Q90YI3 300 ----HHIIGKDILKFHAIYWPSFLLGAGLPLPQTIHVHSHWTVAGKKMSKSLGNVIDPQERSQL-FTTDGLRYFLLR-QG 373 torafugu
Q2YQ76 258 ----AHIIGKDISRFHAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVER-YGLDQLRYFLMR-EV 331 Brucella abortus 2308
Q9PQU6 262 --eiVHLLSKEIARFHCIYWPIFLNDLQIRFPSTILSHGWIITKEGKMSKSLGNVIDPNVLIDT-YGVDALRYYLMA-DL 337 Ureaplasma parvum ser...
Q5L3W2 256 ----VHLVGKEIVRFHTIYWPIILMALGLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVTLIDR-YGLDALRYYLLR-EV 329 Geobacillus kaustophilus
Q8EZD6 313 nseiVHFIGKDILYFHTLFWPAMLEGSDYRAPSKVHVHGFIGVNGEKMSKSRGTFIKAETFVKY-LDPEHLRFYLASkLG 391 Leptospira interrogan...
Q8PAY7 284 qtelHHFIGKDIVNFHGLFWPAVLHGTGHRAPTRLHVNGYLMVDGAKMSKSRGTFVMARTFLDVgLEPEALRYYFAAkSS 363 Xanthomonas campestri...
P43828 285 daelYHFIGKDIVYFHSLFWPAMLEGSGYRKPTNVFAHGYVTVDGAKMSKSRGTFIQASTYLNH-IDPECLRYYYAAkLN 363 Haemophilus influenza...
P57210 286 nyelYHFIGKDIIYFHTLFWPAILEAVSFRQPSGIFVHGHLTMNGLKLSKSRGALIKASDWIQY-FDSDSLRYYYASkLS 364 Buchnera aphidicola s...
Q8D219 285 kseiYQFIGKDVIYFHSLFWPAILHGINLKKPTKLFVHGHVTLNGEKMSKSNGFVIKAKTYLKY-CDSDFLRYYFSMkIS 363 Wigglesworthia glossi...
4DLP_A 353 PFGQDGSYSHEAIVNRTNADLANDLGNLAQRSL 385 Brucella abortus 2308
Q90YI3 374 VPDTDCDYRDDKVVKLLNAELADALGGLLNRCT 406 torafugu
Q2YQ76 332 PFGQDGSYSHEAIVNRTNADLANDLGNLAQRSl 364 Brucella abortus 2308
Q9PQU6 338 SLFRDAIFSEDNLIETYNTQLANSYGNMISRTL 370 Ureaplasma parvum serovar 3 str. ATCC 700970
Q5L3W2 330 PFGADGVFTPEGFIERINYDLANDLGNLLHRTV 362 Geobacillus kaustophilus
Q8EZD6 392 PGMDDIDLSFEDFINKVNSDLVGNLINSVSRVS 424 Leptospira interrogans serovar Lai str. 56601
Q8PAY7 364 GGVDDLDLNLGDFVARVNADLVGKFVNLASRCA 396 Xanthomonas campestris pv. campestris str. ATCC 33913
P43828 364 DRIEDLDFNLEDFVQRVNTDIVNKLVNLASRNA 396 Haemophilus influenzae Rd KW20
P57210 365 NKTHDIEINLEDFIQKINSDIVNKLVNLAARNA 397 Buchnera aphidicola str. APS (Acyrthosiphon pisum)
Q8D219 364 SCAKDIDFSLSDFMNKVNSNIINKIVNLASRSS 396 Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap