4DLP


Conserved Protein Domain Family
tRNA-synt_1g

?
pfam09334: tRNA-synt_1g 
Click on image for an interactive view with Cn3D
tRNA synthetases class I (M)
This family includes methionyl tRNA synthetases.
Statistics
?
PSSM-Id: 337365
View PSSM: pfam09334
Aligned: 25 rows
Threshold Bit Score: 465.223
Threshold Setting Gi: 25009406
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DLP_A        27 YYITTAIAYPNGKPHIGHAYELIATDAMARFQRLN-GMDVYFLTGTDEHGIKMLQSARKEGITPRDLADRNTSAFRRMAE 105
gi 123727379   6 YYITTAIAYPNGKPHIGHAYELIATDAMARFQRLN-GMDVYFLTGTDEHGIKMLQSARKEGITPRDLADRNTSAFRRMAE 84
gi 25009406    7 FFISTPIYYSSGNPHIGHAYTTIIADVLARYKRLF-GYDVFFLTGMDEHGQKIQQKAFEENISPKALVDRNSIIFLNLWK 85
gi 81348383    6 FYLTTPIYYPSDRLHIGHAYTTVAGDAMARYKRMR-GYDVMYLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWK 84
gi 74680333   20 FYITTPICYVNAAPHIGHLYSMLIADTRNKWEKLNpSKESFMLTGTDEHGLKIQSTAEKLGLEPKVLVDKVSQNFSKLAE 99
gi 82245502   44 YYITTPIFYVNASPHLGHLYSAVIADCFHRHKQLQ-GFNSRFATGTDEHGLKIQQAAEAAGKEPLEFCTTVSERFRHLFS 122
gi 25009358    5 ALVTTALPYANGPLHLGHLVGYIQADIWVRARRLR-GDKTWFVCADDTHGTPIMLAAEKAGVTPEAFIANIQASHERDFA 83
gi 1174532     8 ILVTCALPYANGAIHLGHMLEHIQADIWVRFQRMR-GNKIHFVCADDAHGTPIMLNADKLGITPEELIAKAKADHIRDFA 86
gi 11134932    8 ILVTCALPYANGSIHIGHMLEHIQADIWVRYHRMR-GHEVWFVSADDAHGTAIMLKAQDLEISPNKLIKNIRIEHQIDFS 86
gi 68566006    7 ILTTCAFPYANGSLHIGHILEHIQADIWVRFNRMI-GNEIYFICADDSHGTPIMIKAKKNKISPEKMVFLFYKEHKNDLS 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DLP_A       106 VLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYAGWYSVRDEAYYGEEE-T-----EV--------RADGVRY- 170
gi 123727379  85 VLNSSNDDYIRTSEERHYKASQAIWQAMVANGDIYKGGYAGWYSVRDEAYYGEEE-T-----EV--------RADGVRY- 149
gi 25009406   86 RLNISFSKFIRTTQMDHEESVQKVFSYLYKQGKIYLGQWTGYYCVSCEENYNPAEiiksqdniMl--------------- 150
gi 81348383   85 KLDISYDDFIRTTQERHKKVVEQIFTRLVEQGDIYLGEYEGWYCTPCESFYTERQlV-----DGnc-------------- 145
gi 74680333  100 QFDVNYDRFIRTTDNDHIELVRYFWNLMMEKGFIYTDTHSGWYSISDETFFPETQ-I-----EEv--------------- 158
gi 82245502  123 SCNISNTDYIRTTEQRHHRAVQHFWSVLCSKGLIYKGSYEGWYSTQDESFLTPSQvtta----------ldsTGKEIKVs 192
gi 25009358   84 AFGVTFDHYDSTNSPVNRELTEAFYTKLEAAGHISRRSVAQFYDPAKGMFLPDRY-I-----KGicpncgsaDQYGDNC- 156
gi 1174532    87 GFNISFDNYHSTHSEENKQLTAEIYNKLKANGFIKSKVISQLFDPEKNMFLPDRF-V-----KGtcpkckaeDQYGDNC- 159
gi 11134932   87 NFKISHDNYYSTHSLENLYLSRKIFTCLNEKGLIKEKKIFQLYDTVKKIFLPDRF-I-----KGtcpickskNQYGDNC- 159
gi 68566006   86 KFNISYDNYYLTHSKENYRFCKLIYKLLKRKKLIFSKYISQFYDCKINMFLSDRL-I-----QGkcpecnseKQYSDNC- 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DLP_A       171 GPQGTPVE----------------WV-EEESYFFRLSAYQDKLLDLY-ENNPGfimPAERRNEIV-SFV--KSgLKDLSI 229
gi 123727379 150 GPQGTPVE----------------WVe-EESYFFRLSAYQDKLLDLY-ENNPGfimPAERRNEIV-SFV--KSgLKDLSI 208
gi 25009406  151 cRMGHKLE----------------TKs-EESYFYKMSDQAPFLKTYY-QNHPNfiiPNERANEMVnNFL--NN-LEDLSI 209
gi 81348383  146 pDCGRPVE----------------KVk-EESYFFRMSKYVDRLLQYY-EENPDfiqPESRKNEMInNFI--KPgLEDLAV 205
gi 74680333  159 vKNGKAVKisset-------knevVYqKETNYFFKLSMFQEQLIQFL-KQNPEfikPKHRYQFILkELE--DTkLPDLSI 228
gi 82245502  193 LESGHKVE----------------WMk-EENYMFRLSGFRSQLLDWL-RENPRa-iQPERFHHSVlQWL--QEeLPDLSV 251
gi 25009358  157 EVCGATYAptelkepksvisgatpELrDSEHFFFEVGHFDGFLREWLdGDV-----ALPGVKAKLkEWLdaEGgLRAWDI 231
gi 1174532   160 EVCASTYSpmdlinprsavsgttpIVkESEHFFFDLPAFEGMLKEWTrSGS-----LQSEIANKMqEWF--ESdLQQWDI 232
gi 11134932  160 EICSATYEptdlinpisvisgkkpILkNTKHLYFDLPSFTNMLKKWIhSGV-----LEESVIKKTeEWF--KVgLKSWAI 232
gi 68566006  159 NICGANYCstdvinpisilsksvpIIkKSKHLFFDLPKFEKFLKKWIhSGV-----LKKENLRKVsEWF--KNgLKPWDI 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DLP_A       230 S---RtTFDW-GIPVPGDEKHVMYVWVDALTNYITALGYP----DTTDE-RW-----AYWp-AN-----AHIIGKDISRF 289
gi 123727379 209 Sr--T-TFDW-GIPVPGDEKHVMYVWVDALTNYITALGYPd----TTDE-RWa-----YWpaN------AHIIGKDISRF 268
gi 25009406  210 Sr--T-TFDW-GIPIAENPKHVIYVWLDALMNYLTATGYLs----NNEE-LFq----KYWcdNet--eiVHLLSKEIARF 274
gi 81348383  206 Sr--T-TFDW-GIKVPGNPKHVIYVWIDALANYITALGYGt----DNDE-KFr----KYWpaD------VHLVGKEIVRF 266
gi 74680333  229 SrpsS-RLKW-SIEVPNDSTQKIYVWFDALLNYLTATKFPhg-fEVQDS-KFvtpenSIWp-------aTHVIGKDIIRF 297
gi 82245502  252 SrqkS-RLQW-GIPVPEDDGQTIYVWLDALVNYLTVVGY--------PN-NHe----RWWnvA------HHIIGKDILKF 310
gi 25009358  232 S---R-DAPYfGFQIPGQPGKYFYVWLDAPIGYLCSFKTLcaqmG---E-DFq----AHLa-AGtqtelHHFIGKDIVNF 298
gi 1174532   233 S---R-DAPYfGFEIPGAKDKFFYVWLDAPIGYMASFKNLcnreGi----DFn----EFWa-EGsdaelYHFIGKDIVYF 299
gi 11134932  233 S---R-DAPYfGFKIPNYPNKYFYVWLDAPIGYISAFKNLcfksK---KlNFn----ELWn-QNsnyelYHFIGKDIIYF 300
gi 68566006  232 S---R-DAPYfGFKIPNEKEKYFYVWLDAPIGYLSTFKNLcdkkE---KiFFs----EFWd-VNskseiYQFIGKDVIYF 299
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4DLP_A       290 HAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVER-YGLDQLRYFLMR-EVPFGQDGSYSHEAIVN 367
gi 123727379 269 HAVYWPAFLMSAQLPLPKRVFAHGFLFNRGEKMSKSVGNVIDPFELVER-YGLDQLRYFLMR-EVPFGQDGSYSHEAIVN 346
gi 25009406  275 HCIYWPIFLNDLQIRFPSTILSHGWIITKEGKMSKSLGNVIDPNVLIDT-YGVDALRYYLMA-DLSLFRDAIFSEDNLIE 352
gi 81348383  267 HTIYWPIILMALGLPLPKKVFGHGWLLMKDGKMSKSKGNVVDPVTLIDR-YGLDALRYYLLR-EVPFGADGVFTPEGFIE 344
gi 74680333  298 HCIYWPIFLMAAGIELPKQVIVHSHWLCDGFKMSKSLGNVVDPMEISEY-YGVDPVRFFLVE-NSNIDDDCKFS-EELLQ 374
gi 82245502  311 HAIYWPSFLLGAGLPLPQTIHVHSHWTVAGKKMSKSLGNVIDPQERSQL-FTTDGLRYFLLR-QGVPDTDCDYRDDKVVK 388
gi 25009358  299 HGLFWPAVLHGTGHRAPTRLHVNGYLMVDGAKMSKSRGTFVMARTFLDVgLEPEALRYYFAAkSSGGVDDLDLNLGDFVA 378
gi 1174532   300 HSLFWPAMLEGSGYRKPTNVFAHGYVTVDGAKMSKSRGTFIQASTYLNH-IDPECLRYYYAAkLNDRIEDLDFNLEDFVQ 378
gi 11134932  301 HTLFWPAILEAVSFRQPSGIFVHGHLTMNGLKLSKSRGALIKASDWIQY-FDSDSLRYYYASkLSNKTHDIEINLEDFIQ 379
gi 68566006  300 HSLFWPAILHGINLKKPTKLFVHGHVTLNGEKMSKSNGFVIKAKTYLKY-CDSDFLRYYFSMkISSCAKDIDFSLSDFMN 378
                        410
                 ....*....|....*...
4DLP_A       368 RTNADLANDLGNLAQRSL 385
gi 123727379 347 RTNADLANDLGNLAQRSl 364
gi 25009406  353 TYNTQLANSYGNMISRTL 370
gi 81348383  345 RINYDLANDLGNLLHRTV 362
gi 74680333  375 RSRDAVLGKYCNLISRIg 392
gi 82245502  389 LLNAELADALGGLLNRCT 406
gi 25009358  379 RVNADLVGKFVNLASRCA 396
gi 1174532   379 RVNTDIVNKLVNLASRNA 396
gi 11134932  380 KINSDIVNKLVNLAARNA 397
gi 68566006  379 KVNSNIINKIVNLASRSS 396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap