Conserved Protein Domain Family
DUF1978

?
pfam09321: DUF1978 
Domain of unknown function (DUF1978)
Members of this family are found in various hypothetical proteins produced by the bacterium Chlamydia pneumoniae. Their exact function has not, as yet, been identified.
Statistics
?
PSSM-Id: 312723
View PSSM: pfam09321
Aligned: 4 rows
Threshold Bit Score: 284.508
Threshold Setting Gi: 75421913
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75421913   44 EDKEKCaeAEKAFLEQQKILLDYGKSIFWLNENDEINL---NDPWSWGLNTVRTRKV--------FQEVDDSERWNHKVL 112
gi 7189683   535 EDNKKT--IMKEHAEMLESLSSYRKVFLALSDENVVDTp--SDPKKWDLSGIPCRDA--------LSEISRDEQWQKKAH 602
gi 4376300   261 QDKNKSarAEQRFREVKDRWEDLKETVFWVKENGCIDLevlTAVGGW-----PDRGPehlipekrRNKVMSHKLWEATMR 335
gi 820663543 269 RDDAKSgcAEKKLRDAEERWKKFRKAVFWVEEDGGFDIn--NLLGDWGTVLDPYRQEr-------MDEITFHELYEKTTF 339
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75421913  113 IQKLEDNYEKLLEESSKESTEANKKLLSDLVDRLEDAKTKFFLKKQEEVETRVKDLRARYGGTVDPKQDTEAKKKVELEA 192
gi 7189683   603 LKHQESLYTQARDRLTDQSSKENQKELEKAEQEYISSWERVKKFEIERVQERIQAIQKLYPNILEREEETTGQETVTPTV 682
gi 4376300   336 MKGAEGTYSVARVAFEKDGSRKNQKKFQEKTKEWLRCLKDLHDQECHRARERLAELEALYPEVSVSVVETERETKF---- 411
gi 820663543 340 LKRLHRKCALAKTTFEKKRSKKNLQAVEEANARRLKYVRDWYDQEFQKAGERLEKLHALYPEVSVSIRENKIQETRS--- 416
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75421913  193 -------SLETFLDSIESELVQCLEDQDIYWKEQDVKDLARTQELEEQDIEAKr-EEAAEDLRSLNERLKKSKTMLDRAK 264
gi 7189683   683 qgttassDLTDILGRIEVSSREDNQNQESCVKVLRSHEVEMSWEVKQEYGPKK--KEFQDQMGSLERFFTEHIEELEVLQ 760
gi 4376300   412 -------KLETAYGNLEERYQSVVRDQEDYWKEEENKE----AEFREKGTKVRspEEVVEYLQILENLSEDCSKQLTIAE 480
gi 820663543 417 -------NLEKAYEAIEENYRCCVREQEDYWKEEEKRE----AEFRERGNKILspEELESSLEQFDHGLKNFSEKLMELE 485
                        250       260
                 ....*....|....*....|..
gi 75421913  265 WHIENAEDSITWWTSQIEMKDM 286
gi 7189683   761 KDYSKHLSYFKKVNNKKEVQYA 782
gi 4376300   481 VVVLGVELEATAEFEYTILSDA 502
gi 820663543 486 GHILKLQKEATAEVENKILSDA 507
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap