1MJE


Conserved Protein Domain Family
BRCA-2_helical

?
pfam09169: BRCA-2_helical 
Click on image for an interactive view with Cn3D
BRCA2, helical
Members of this family adopt a helical structure, consisting of a four-helix cluster core (alpha 1, alpha 8, alpha 9, alpha 10) and two successive beta-hairpins (beta 1 to beta 4). An approx. 50-amino acid segment that contains four short helices (alpha 2 to alpha 4), meanders around the surface of the core structure. In BRCA2, the alpha 9 and alpha 10 helices pack with BRCA-2_OB1 (pfam09103) through van der Waals contacts involving hydrophobic and aromatic residues, and also through side-chain and backbone hydrogen bonds. The domain binds the 70-amino acid DSS1 (deleted in split-hand/split foot syndrome) protein, which was originally identified as one of three genes that map to a 1.5-Mb locus deleted in an inherited developmental malformation syndrome.
Statistics
?
PSSM-Id: 312623
View PSSM: pfam09169
Aligned: 15 rows
Threshold Bit Score: 259.222
Threshold Setting Gi: 170054383
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJE_A          25 MSSLQSARDLQDMRIKNKERRHLRLQPGSLYLTK-SSTLPRISLQAA-------VGDRAPSACSPKQLYIYGVSKECINV 96
gi 952011477  2481 ITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAK-TSTLPRISLKAA-------VGGQVPSACSHKQLYTYGVSKHCIKI 2552
gi 122117134   467 AEARKLSMQRQQSYIESKPLEERRPRLTEFISKK--QMRGRSTLRQF-------VENRNPS---------CSVPEKLRDV 528
gi 119395734  2481 ITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAK-TSTLPRISLKAA-------VGGQVPSACSHKQLYTYGVSKHCIKI 2552
gi 1043434280 2124 TSNLRCSKDLQEMRIRKKLRQKIKPHPGSLYRLK-MSHVKRISLQSA-------VAERCPTLYSREQLYRYGIVKNHIGV 2195
gi 736307084  2104 fPNVELARDVQDMRIRKKKRQTIRPLPGSLLLTK-TSGGSRIPLKAAvngkppvI-------YSQKQLYGHGVHQHVCEI 2175
gi 146738007   147 LHNVELARDMQDMRIRKKKRQTILPLPGSLFLKK-SSGVTRIPLKSA-------VNGKPPARYTPKQLYGLGVPLNVLEI 218
gi 542233641  2443 LQNTELAQDMQDMRIRKKKRQNIRPLPGSLYLKK-TSGVPRIPLKAA-------VNGKIPGRYTPKKLYGYGVQKYVSDI 2514
gi 146219852  2427 MANLHCARDLQEMRIKKKYRQNISPQPGSLYVTK-TSARNRISLKTA-------VEEETPSFHSTEKLYTYGVSKHCIQV 2498
gi 1033399607 1714 IASLHCARNLQEMRILKKQKQVIGPQPGTLYLMKiCATSCRIPLKTA-------VDEKCPGSYFSEQLYAFGVSKQCLNV 1786
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1MJE_A          97 NSKNAEYFQFDIQDHFGKEDLCAG-KGFQLADGGW--LIPSNDGKAGKEEFYRALCDTPGVDPKLISSIWVANHYRWIVW 173
gi 952011477  2553 NSKNAESFQFHTEDYFGKESLWTG-KGIQLADGGW--LIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIW 2629
gi 122117134   529 IADNAMNFKFDMIEFYTKTECLENvDGIVLGDSNTttLFFNERCQAGLPEFKLAFLASPGIDPALVPAGWIENCWVWTII 608
gi 119395734  2553 NSKNAESFQFHTEDYFGKESLWTG-KGIQLADGGW--LIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIW 2629
gi 1043434280 2196 SSENALSFQFHCSNYFTKELLLSG-NGVQLADGGW--LIPTEQGNAGKEEIYRAFCDTPGVDPKLISAEWVHNHYRWIVW 2272
gi 736307084  2176 TSETAESFRFNLQQFIRREALVEG-GGVQLADGGW--LIPSKDGTAGKEEFYRALCDTPGVDPKLMSEAWAYNHYRWIVW 2252
gi 146738007   219 TSETAGSFRFSLQQFVKLESLTDK-GGIQLADGGW--LIPRNDGTAGKEEFYRALCDTTGVDPKLISEEWVYNHYRWIVW 295
gi 542233641  2515 TSENAESFRFNLLQFIKREAFTDE-GGVQLADGGW--LVPSNDGTAGKEEFYRALCDTLGVDPKLISEAWVYNHYRWIVW 2591
gi 146219852  2499 NSTNAESFQFLIEEFFSKEYLLAG-NGIQLADGGW--LIPTDEGKAGKKEFYRALCDTPGVDPKLITEAWVYNHYRWIVW 2575
gi 1033399607 1787 NSSNAEHFQFHIQDFFGRECFLDG-NGIQLADGGY--LIPTDDGKAGKEEFYRALCDTPGVDPKLISKAWVYNHYKWIIW 1863
                          170       180       190
                   ....*....|....*....|....*....|....*...
1MJE_A         174 KLAAMEFAFPKEFANrCLNPERVLLQLKYRYDVEIDnS 211
gi 952011477  2630 KLAAMECAFPKEFANrCLSPERVLLQLKYRYDTEIDrS 2667
gi 122117134   609 KLTSMERNLPDYFHG-ITTLENMLNQIMYRYHLEIDsA 645
gi 119395734  2630 KLAAMECAFPKEFANrCLSPERVLLQLKYRYDTEIDrS 2667
gi 1043434280 2273 KLAAMEVRFPKTFACrCLTPERVLLQLKYRYDVEIDkS 2310
gi 736307084  2253 KQASMERSFPESMGSlCLTPEQLLLQLKYRYDVEVDhS 2290
gi 146738007   296 KQASMERSFPEQLGSlCLTPEQVLLQLKYRYDIEVDqS 333
gi 542233641  2592 KQASMEKSFPEIVGSrCLTPEQVLLQLKYRYDVEVDhS 2629
gi 146219852  2576 KLAAMEVCFPHKFANrCLTPETVLLQLKYRYDLEIDkS 2613
gi 1033399607 1864 KLAAMEVAFPQEFASkCLTPERVLLQLKYRYDVEVDkS 1901
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap