2XJ4


Conserved Protein Domain Family
MipZ

?
pfam09140: MipZ 
Click on image for an interactive view with Cn3D
ATPase MipZ
MipZ is an ATPase that forms a complex with the chromosome partitioning protein ParB near the chromosomal origin of replication. It is responsible for the temporal and spatial regulation of FtsZ ring formation.
Statistics
?
Aligned: 9 rows
Threshold Bit Score: 408.383
Threshold Setting Gi: 1378072883
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2XJ4_A                    5 RVIVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVIDLDLRQRTSARFFENRRAWLDNKKIELPEPLAlnlsdndvaLAER 84  Caul...
GLBRC_NREL:ZMO1_ZMO0335   7 YFIVFANEKGGSGKSTTAVHVAVALSAKGLKVAAVDLDTRQRTFARYMENRVESVKRIGMDLPTPET---------KVFD 77  Zymo...
Q2G320                    6 HRIVFANEKGGTGKSTTAVHVAVALAYQGARVATIDLDARQRTMHRYFENRAETMRRREIALPTASF---------DVYG 76  Novo...
Q2N658                    7 HRVVFANEKGGTGKSTTAVHVAVALAYKGARVAAIDLDHRQRTMHRYFENRSETEARRGISLPGTRC---------EVYD 77  Eryt...
Q2W0K2                   29 HVIVVGNEKGGTGKSTISMHLIVSLLDRGLSVGSIDIDARQATLTRYIGNRAARQDRTELSLPIPEHmai------ppTG 102 Magn...
CAL78289                 14 HVVVLGNEKGGSGKSTTALHIAVALLKAGQRVATIDLDCRQQSFTHYINNRSAWARRTGLRLELPTHyciqlgqtlQIDE 93  Brad...
Q28UF7                    3 HIIVLGNEKGGSGKSTTSMHVATALARMGHVVGGLDLDLRQRSFHRYLGNRLATAERKGLDLACPMIlelpdaapeDVPD 82  Jann...
Q3IZ08                    3 HIIVVGNEKGGSGKSTTCMHVATALVRLGFRVGALDLDLRQRSFGRYVENRLAFAESSGLSLPMPDYrvlpeveesEVPE 82  Rhod...
Q9A6C9                    5 RVIVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVIDLDLRQRTSARFFENRRAWLDNKKIELPEPLAlnlsdndvaLAER 84  Caul...
2XJ4_A                   85 PEEEQvaGFEAAFARAMAECDFILIDTPGGDSAITRMAHGRADLVVTPMNDSFVDFDMLGTVDPVTLELTKPSLYSLTVW 164 Caul...
GLBRC_NREL:ZMO1_ZMO0335  78 PDSGD--DLNLLLDELSQNYDFVIVDTPGRHSSDIRSALERADSLVTPINDSFVDLDLIGQVDPESYHIKRPSFYAELVW 155 Zymo...
Q2G320                   77 QDSIE--ALDELTERLGQGYDFIVFDTPGRDDPLARHVATRADTLVTPLNDSFVDFDLIGQVDAETFKVRRLSFYAELIW 154 Novo...
Q2N658                   78 GEDIG--ELEALAADLSREADFLIFDTPGRDDPLARHAATEADTLVTPLNDSFVDFDLIGQVDAETFKVRRLSFYAELIW 155 Eryt...
Q2W0K2                  103 DASADcaRLEEVFRDFAARHDVVVIDTPGSDHPMSRLGHSFADTLVTPLNDSLVDLDVLALVEPGSMKIRRPSHYAEMVW 182 Magn...
CAL78289                 94 NENTEfqQFMEAVSAVERSFDFIVIDTPGNDSYLMRLAHSMADTLVTPINDSFLDFDVLGTVDAATYAVTGESHYAEMVR 173 Brad...
Q28UF7                   83 GVNIYdhRLSAAVADQESRCDFIVIDCPGSHTRLSQVAHSLADTLITPLNDSFVDFDLLAKIDPETFALKGPSVYSEMVW 162 Jann...
Q3IZ08                   83 GENPLdvRMAKAMAALEPVSDFILIDCPGSHTRLSQVAHSLADTLVTPLNDSFVDFDLLARIDPETGKVKGPSIYAEMVW 162 Rhod...
Q9A6C9                   85 PEEEQvaGFEAAFARAMAECDFILIDTPGGDSAITRMAHGRADLVVTPMNDSFVDFDMLGTVDPVTLELTKPSLYSLTVW 164 Caul...
2XJ4_A                  165 EGRKQRALSg---QRQAMDWVVLRNRLATTEARNRKRLEDRLNALAKRVGFRIGPGLRDRVIYRELFPFGLTIA-DLSPQ 240 Caul...
GLBRC_NREL:ZMO1_ZMO0335 156 EARKARGKR----DGKTVDWIVLRNRLQHLEARNMRHVASAMTELSKRVGFRIISGLSERVIYRELFLKGLTLL-DVKAL 230 Zymo...
Q2G320                  155 EARKKRAMAtikdARREMDWVVVRNRTGYTEARNQRRIDQALTELSKRVGFRIASGLSERVIYRELFPSGLTLL-DKGHL 233 Novo...
Q2N658                  156 ESRIKRSKAtleeQRREMDWVVVRNRTGYTEARNMQRIERALAELSKRVGFRVTSGLSERVIYRELFPSGLTLL-DKGQL 234 Eryt...
Q2W0K2                  183 ETKKARAMRg---EKAVVDWIVLRNRLSTLDARNKRDMEKLLADLSKRVGFRVIPGLGERVIYRSMFLEGLTLI-DLKKK 258 Magn...
CAL78289                174 DVRRKRRQV----DGAMTDWIVVRNRLSMLGSRNKQLVAEGLKDLSLRLGFRAIDGFAERVVYREFFPRGLTALdDIDEA 249 Brad...
Q28UF7                  163 HARQLRAKA----GLQPTDWVVVRNRLPAQQMHNKAKMGRALEELSKRIGFRVAPGFSERVIFRELFPSGMTLL-DLRDM 237 Jann...
Q3IZ08                  163 SARQFRAQA----GLKPIDWIVLRNRLGAQQMHNKKKVGAALEDLSRRIGFRVAAGFSERVIFRELFPRGLTLL-DLRDT 237 Rhod...
Q9A6C9                  165 EGRKQRALSg---QRQAMDWVVLRNRLATTEARNRKRLEDRLNALAKRVGFRIGPGLRDRVIYRELFPFGLTIA-DLSPQ 240 Caul...
2XJ4_A                  241 VrpvPVSLQHLAARQELRALMHSLGLS 267 Caulobacter vibrioides
GLBRC_NREL:ZMO1_ZMO0335 231 G---RAGLGHVAARQELRDLIAGLKLS 254 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
Q2G320                  234 G---ELGTSHLVARQELRTLVSGLNLP 257 Novosphingobium aromaticivorans DSM 12444
Q2N658                  235 G---DLGTSHLVARQELRQLVLGLNLP 258 Erythrobacter litoralis HTCC2594
Q2W0K2                  259 PlgfDFNMSHVAARQELRTLVEAIGLG 285 Magnetospirillum magneticum AMB-1
CAL78289                250 TlgtRPNLGHVTAREEVTSLLRQLKLP 276 Bradyrhizobium sp. ORS 278
Q28UF7                  238 Gv-eRMNISNVAARQELRDLIAALNLP 263 Jannaschia sp. CCS1
Q3IZ08                  238 Gv-eQLSLSNIAARQEVRDLLIELKLP 263 Rhodobacter sphaeroides 2.4.1
Q9A6C9                  241 VrpvPVSLQHLAARQELRALMHSLGLS 267 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap