2QNF


Conserved Protein Domain Family
Endonuc-dimeris

?
pfam09124: Endonuc-dimeris 
Click on image for an interactive view with Cn3D
T4 recombination endonuclease VII, dimerization
Members of this family, which are predominantly found in Bacteriophage T4 recombination endonuclease VII, adopt a helical secondary structure, with three alpha helices oriented parallel to each other. They mediate dimerization of the protein, as well as binding to the DNA major groove.
Statistics
?
PSSM-Id: 337301
View PSSM: pfam09124
Aligned: 3 rows
Threshold Bit Score: 108.334
Threshold Setting Gi: 75082171
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QNF_A 104 IHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRKSLK 157 Enterobacteria phage T4
P13340 104 IHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRKSLK 157 Enterobacteria phage T4
Q6WI21  83 YHPQHPKDQTKIFSRLKLQEQKEHLDSLGIKYPDNAKKSDLEKIYRKSFLHNPR 136 Vibrio phage KVP40
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap