Conserved Protein Domain Family
MIF4G_like

?
pfam09088: MIF4G_like 
MIF4G like
Members of this family are involved in mediating U snRNA export from the nucleus. They adopt a highly helical structure, wherein the polypeptide chain forms a right-handed solenoid. At the tertiary level, the domain is composed of a superhelical arrangement of successive antiparallel pairs of helices.
Statistics
?
PSSM-Id: 286213
View PSSM: pfam09088
Aligned: 7 rows
Threshold Bit Score: 317.056
Threshold Setting Gi: 74584574
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74584574   348 PPIETYLGLFFKDIAFDILTNLSFNKNETAIELSILDMFFDNKLFAPPGTSIDQLnaiyednksGTNDPSLSTWKIEDVA 427
gi 74667622   127 PPTSDIASSLLREALVDTINILDFNRIATAKFLIDVDCYFTPYTFVKRATPFDRL---------RDLPGDRPTWKPEDVA 197
gi 121781714  312 PPLTHIAASVIRDALLDTINVLHINRNVTARHLIDLDCYFSPRTFAARATPFDKL---------RDIEPPKSTWKPEDVA 382
gi 74636068   324 PDPKSYDAVLWRDMLSDTIQNLDFNRKECAKQLFTLDLFLNKGTFTGPGISVDKLsgkf--ldaKADDRPISTLKVEDVA 401
gi 74581995   309 PDASDVAASIFRDISVDVINHLEFNRVEAAQVLTDLDVYFTYKTFALRGTPVNEL---------PNLDPSESRWKAEDII 379
gi 74687213   379 PSPSTLDGWYLRSLVLDIINLYEVNRKECSRLLLELRKFLPRDTFKPIVPLPED------------ASPPPSTWSLESLV 446
gi 758987643  439 PAVASPASVVLRAILADMIDLYEVNRKEAAKLILDLPNWLRRATFNLKVSSDAGLfge-----mgdVNPGESNWSLDDLL 513
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74584574   428 VESILTMIFQLPNPLEVEIYYYTVLISCCRESPESIAPVFGRAIRYFYNHLET--LDYELKIRFLDWMSIQLSNFEFSWK 505
gi 74667622   198 VDAVFSQLFQLPSPEHKLVYYHSVLTECCKIAPAAIAPSLGRAIRFLYRSLDT--IDLELMHRFLDWFAHHLSNFGFTWK 275
gi 121781714  383 VDAVFSQLFQLPTPEQKLVYYHSVLTEACKLAPAAIAPSLGRAIRHLYRNTPR--LDLELSSRFVDWFAHHLSNFGFTWK 460
gi 74636068   402 SEAILAELFRLATPPLQPAYFHSLFIEACIMAPQAIAPVFGRAVRFLFANLRS--FDTELIHRFLDWFSHHLSNFGFTWK 479
gi 74581995   380 VEAVLGELLGSQNTTYKPVYYHSLLIECCRIAPKILAPTFGRVIRLMYTMSSD--LPLQTLDRFIDWFSHHLSNFNFHWK 457
gi 74687213   447 VSTLLGAMLTLPKSHHKLIYYGSVITELCKASPNTVAPPVGRSMRKIFSLLGTegLDVEIVRRVAEWFSVHLSNFGFQWM 526
gi 758987643  514 VETILSTAFVLPTPPRNPLYYTSLLREIVTLTPGTVAPSLGKTIRTFYDALSSrnMDVETIHRFADWFAIHLSNFNFGWA 593
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 74584574   506 WEEWVSDSkKLKDLkyHPKKNFIKNLIAKEIRLSNKKRIKDSFID 550
gi 74667622   276 WSEWIEDL-ELPLV--HPRMAFITGAIDKEIRLSFAQRIRGTLPD 317
gi 121781714  461 WTEWVDDV-SLPDA--HPRKAFIAGALDKEIRLSFAQRIKNTLPD 502
gi 74636068   480 WQEWVEYV-DLEPL--DPRLVFIKQLIKKELRLSFESRIKETLPD 521
gi 74581995   458 WNEWIPDV-ELDDL--HPKKVFMRETITRELILSYYTRISDSLPE 499
gi 74687213   527 WKEWVPDL-ELPSS--HPRRAFMRRVIELEVRLSYYDRILETLPE 568
gi 758987643  594 WKEWIPDT-TLPAA--HPKIVFMKRVVELEIRLAYFDRVKQTLPD 635
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap