Conserved Protein Domain Family
CENP-B_dimeris

?
pfam09026: CENP-B_dimeris 
Centromere protein B dimerization domain
The centromere protein B (CENP-B) dimerization domain is composed of two alpha-helices, which are folded into an antiparallel configuration. dimerization of CENP-B is mediated by this domain, in which monomers dimerize to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation.
Statistics
?
PSSM-Id: 286159
View PSSM: pfam09026
Aligned: 2 rows
Threshold Bit Score: 150.178
Threshold Setting Gi: 395508874
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940344 499 PTLHFLEGGEDSDSDSDEEEDDEEEDEEDEDEEDDEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDL 578
gi 395508874 234 PAVQLLEAGEDSESESDEEDEEDDDDDEDDDDDDDEDDDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDL 313
                         90       100
                 ....*....|....*....|
gi 341940344 579 VHVTRKNHARQAGVRGLGHQ 598
gi 395508874 314 VHVTRKNHARQASSRALAHQ 333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap