Conserved Protein Domain Family
Pas_Saposin

?
pfam09016: Pas_Saposin 
Pas factor saposin fold
Members of this family adopt a compact structure comprising five alpha helices. Charged and polar residues are exposed mostly on the surface, while most of the hydrophobic residues are buried inside the hydrophobic core of the helical bundle. The precise function of this domain is unknown, but it is has been shown to induce secretion of periplasmic proteins, especially collagenase.
Statistics
?
Aligned: 5 rows
Threshold Bit Score: 113.846
Threshold Setting Gi: 218324928
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
idergo:VAA_00224  1 MKALIYETLISLANQDPEQHAKIRENLYEQLGLPLDKQLALYSRALGPASSGKLENDQAINNAVESAIKLLETPEH 76  Vibrio anguillar...
Q7M7D9            1 MKALIYETLVNLANQDPEQHATIRQNLYEQLDLPFDKQLALYAGALGPASSGKLENHEAISNAVDSVVQLLEIPEH 76  Vibrio vulnificu...
Q87IZ6            1 MKTLIYDTLISLASQEPEQHARIRQNLYEQLDLPFDKQLALYSCALGPASSGKLESSQGINNAVDCAVKLLETPER 76  Vibrio parahaemo...
Q5DZV6            3 TTSLIYNTLTNLATAEPTQCAQIRQKLYDELNLSFDKKFALYSSVLGPVSAGRIDD---LNDAVNKARAILEDKNY 75  Aliivibrio fisch...
CAV26725          3 TTTLIYDTLEGLSSAKPQQHAQIRQNLYNQLDLSFEKQLALYSSVLGPASAGRLTD---LDSAVMSARKIVGL-EN 74  Vibrio tasmanien...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap