2AZE


Conserved Protein Domain Family
DP

?
pfam08781: DP 
Click on image for an interactive view with Cn3D
Transcription factor DP
DP forms a heterodimer with E2F and regulates genes involved in cell cycle progression. The transcriptional activity of E2F is inhibited by the retinoblastoma protein which binds to the E2F-DP heterodimer and negatively regulates the G1-S transition.
Statistics
?
Aligned: 43 rows
Threshold Bit Score: 119.225
Threshold Setting Gi: 74920311
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AZE_A         5 QECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQ-QaSRPPPPNSVIHLPFIIVNTSKKTVIDCSISN 83  human
EFV56925     205 QECKRLEDEKARRAERIRDKREELYELMTQLVAVQSLIKRNREMER-Q-GLLDPNLKLLPLPFLLVRTNSDSVVNVSISN 282 Trichinella spi...
EDQ93069     108 QEARTYAATKRKKEEQVQKLKKQLQALVLQHIAFQNLIKRNQARMQ-E-NPSTEEHDSIQLPFVIVSTRQSAVIDCQMAA 185 Monosiga brevic...
XP_004349872 214 HECEQLNVTKFDLMHRLKLKKEHMQELILQQVAFQTLVQRNKDAQE-Q-KLHTFTTEILKLPFIVITTNSNTEIDCQMEE 291 Capsaspora owcz...
XP_016664633 235 QNSVYLVQEKENRLNSVKRKLLALQEIIMQEVAIKRLVKRNQDMEN-E-FGPPPNNTFVNLPFMAISANEDTSVEVEISE 312 pea aphid
EFH49312     138 KDVEEVKMDRNKVMNSVQKKAAFLKELREKVSSLESLMSRNQEMVV-K-TQGPAEG--FTLPFILLETNPHAVVEIEISE 213 Arabidopsis lyr...
Q9FNY2       189 SDIEELKNERLSLRNRIEKKTAYSQELEEQYVGLQNLIQRNEHLYS-S-GNAPSGG--VALPFILVQTRPHATVEVEISE 264 thale cress
Q84VD5       187 SDVEELKTEIIGLKGRIDKKNAYLQELEDQFVGLQNLAQRNEQLYG-S-GNAPSGG--VALPFILVQTRPHATVEVEISE 262 Japanese rice
Q7KWP1       507 QTNQSIAKQLEDIKERIQAKKKQLKDLNQQEKDYQELHSRNTLLEQrK-DQSLKNK--IFLPFIVLSTQNSTVIDCEVEN 583 Dictyostelium d...
XP_015697184  87 NDVDDLKAQIFGLKGRIDKKNAYLQELQDQFVGLQNLAQRNEQLYG-S-GNAPSGG--VALPFILVQTRPHATVEVEISE 162 malo sina
2AZE_A        84 DKFEYLFNFDNT-FEIHDDIEVLK---RMGMACG--LE-SGSCSAE--------D---LKMARSLVPK--ALEPYVTEMA 143 human
EFV56925     283 DRTQWLFNFNRP-FQLEPDVEFLK---SLGLAHG--LE-KGSLHYA--------D---LVTVKSLLPP--AFAEVMEEAF 342 Trichinella spi...
EDQ93069     186 DQSEYFFDFNEP-FVIHDDLQVLS---QLGLTFG--LE-TGAISDE--------Q---VALARDLLPA--EMGHILDEMV 245 Monosiga brevic...
XP_004349872 292 DRTEYFFNFKQA-FEVHDDIEVLK---RMGMARG--LN-NKSSTAE--------D---LAAIEQLVDE--KLMPYIEEMT 351 Capsaspora owcz...
XP_016664633 313 DQKQYGMSFNDK-FSMVDDTEILK---TMGFTLG--LD-RGEVSNE--------D---LNILKTLVPK--AFEKHIVMMA 372 pea aphid
EFH49312     214 DMQLVHLDFNSTpFSVHDDAYILK---LMQEQKQ-----------Q--------Q---NRVSSSSSTH--HQSQHSSAHS 266 Arabidopsis lyr...
Q9FNY2       265 DMQLVHFDFNSTpFELHDDNFVLK---TMKFCDQppQQpNGRNNSQlvchnftpEnpnKGPSTGPTPQldMYETHLQSQQ 341 thale cress
Q84VD5       263 DMQLVHFDFNSTpFELHDDSFVLK---ALGFSGK---EpDDTQAWV--------G---NGGECSTTP---IY-HQSPQVA 321 Japanese rice
Q7KWP1       584 ERSKYFFNFSQS-FNIIDDDSLVKsvlENPLSNNpsLGnNLPTTIT--------N---RSLSTPILPS------QVSNEP 645 Dictyostelium d...
XP_015697184 163 DMQLVHFDFNSTpFELHDDSFVLK---ALGFSGK---EpNGAEDQV--------A---NGGECSSTPN--IY-HQSPQVA 222 malo sina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap