1FC3


Conserved Protein Domain Family
Spo0A_C

?
pfam08769: Spo0A_C 
Click on image for an interactive view with Cn3D
Sporulation initiation factor Spo0A C terminal
The response regulator Spo0A is comprised of a phophoacceptor domain and a transcription activation domain. This domain corresponds to the transcription activation domain and forms an alpha helical structure comprising of 6 alpha helices. The structure contains a helix-turn-helix and binds DNA.
Statistics
?
Aligned: 182 rows
Threshold Bit Score: 82.9421
Threshold Setting Gi: 524372624
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FC3_A               10 ITS-IIHEIGVPAHIKGYLYLREAIAMVYHDIE-LLGSITKVLYPDIAKKYNTTASRVERAIRHAIEVAWSRGNLESISS 87  Geobacil...
goetting:Cst_c21100 169 VRR-VLMELGVPAHLSGYGYLQMAIVENSLCER-GTIPITKQLYPMIAEAFNTSAGRVERAIRNAIRKVWQEGNRNELSK 246 Thermocl...
WP_021860674         50 IRK-ELQGLGFPSSACGTIYLEEGIFYFIQKQK-RQISITKELYPAVAEKYSTNAANVERNIRTTIEKVWTRGNLQRLDD 127 Dorea
CDE49199            117 aHQ-LLTALGMPRTLRAWAFLPEMAALTVVHPP-LLTDVTHGLYPLMARRAQLTPCAVERRLRLAIESTWNRGDYDAIAR 194 Faecalib...
CCX51148              6 IES-ELLELGAPAGRQGYIQMVTALEFIMQHDD-VMCA-TANLYPYVAERLNTVPPRVERNIREEIYAIWSRGNQDRLNE 82  Clostrid...
CDA52167            290 VTDsILLPLGLQNEHRGTEFLRLLVCMRIFGVD-ADL---KRMYEYVAMYYHSTPAAVERAIRYSIECAWEGGNLYMQFE 365 Clostrid...
CCX41741              5 VEK-ELLLLGAPTGRLGYAQMACAIELILS-ES-QILSTTRVLYPKVAKICGTKPARIERNVREEIRAIWDYGNQARLDT 81  Clostrid...
CCZ46372            118 VTS-ILHELGMSPGLKGYGYIHDAALLALDDPS-LLHAVTKVIYPCVARRNGTTAFCVERAIRHAIEITWERGSRDVWDR 195 Firmicut...
CDE48436             85 IAS-LLRCLGVPARLSGFNYLVETLLLLVNRPF-ETRLVTGEVYPVVAKQCNTTPIGVDQAIRTAVNQTWQEQNIPVYCA 162 Faecalib...
CCX49352            159 IAQ-YLTMMGLAVQHSGFVYAAACIKMYVENGVnSPLRLTQDVYPAVAKRYNTNAKAVERSIRYAINTAWLKGDMEMQHQ 237 Clostrid...
1FC3_A               88 LFGYTVSVSKAKPTNSEFIAMVADKL 113 Geobacillus stearothermophilus
goetting:Cst_c21100 247 YFIYSEKRKNHPPTNSEFISTIANKI 272 Thermoclostridium stercorarium subsp. stercorarium DSM 8532
WP_021860674        128 FGSGMIEYKTGRPTNGTVIHTLARKv 153 Dorea
CDE49199            195 FFGQSVDPERGKPTNREFLCQLQERL 220 Faecalibacterium sp. CAG:74
CCX51148             83 LF---VNREKCPPGSKEFLYTLAHRL 105 Clostridium sp. CAG:226
CDA52167            366 LFGNTTDSAKGKPTNAEFIATVVQHI 391 Clostridium sp. CAG:138
CCX41741             82 MF---YNRDKYPPGNKEFLYTVAKHL 104 Clostridium sp. CAG:1024
CCZ46372            196 YFGH-LCADGGKPANGMFLAELVEAL 220 Firmicutes bacterium CAG:129
CDE48436            163 LMGRSPAPHEPRPTSCEFLANVLmyv 188 Faecalibacterium sp. CAG:74
CCX49352            238 LFGYTVDRDKGCPTNKEYITMIAEHt 263 Clostridium sp. CAG:226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap