5DH9,4FGV


Conserved Protein Domain Family
CRM1_C

?
pfam08767: CRM1_C 
Click on image for an interactive view with Cn3D
CRM1 C terminal
CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES). CRM1 forms a complex with the NES containing protein and the small GTPase Ran. This region forms an alpha helical structure formed by six helical hairpin motifs that are structurally similar to the HEAT repeat, but share little sequence similarity to the HEAT repeat.
Statistics
?
PSSM-Id: 312338
View PSSM: pfam08767
Aligned: 27 rows
Threshold Bit Score: 283.353
Threshold Setting Gi: 74630218
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5DH9_C        686 QLGHIYYNMLQLYRAVSSMISAQVAAEGLIATK----TPKVRGLRTIKKEILKLVETYISKAR----------------- 744  Saccharomyces...
Q23089        719 QLGNIYSDLLSLYKILSEKVSRAVTTAGEEALK----NPLVKTMRAVKREILILLSTFISKNG----------------- 777  Caenorhabditi...
Q7PMB7        691 QLGRIYLDMLNVYKIMSENITQAISLNGLSINN----QPLIKAMHVVKKETLTLISEWVWKSN----------------- 749  Anopheles gam...
Q7RP59        168 QLNLVFFDFLKIYQLYSKYINMEVEANGTKRIK----HAQFRNLFLMKREFLHLIETTIERSCyniqeleeallkreqkk 243  Plasmodium yo...
A0D4D4        233 QLLPTYN---QIYLFYSQSIQQQVLAQGVVVMG----YYTVKKQRAVKKEILKLYATYFQNNDqe--------------- 290  Paramecium te...
XP_001327132  673 QLRIIFNQLMEVYSRYSNLLQQFIGEPGYSETK------EANCFKRIKSKIVLIINDYILKTP----------------- 729  Trichomonas v...
XP_001645797  709 QFEKILEDVVHLYGFSTKFIER-IENTSNNATEfednINILKLLRGIKRNILKLVKLLMRNVH----------------- 770  Vanderwaltozy...
XP_016024187  701 QLGRIYLDMLNVYKITSENIIQAIEVNGVNVNN----QPLIKTMHVVKKETLNLISEWVSRSN----------------- 759  Drosophila si...
XP_001619023   64 QLGRIYLDMLNVYRCLSENISMAISENGELVMK----QPLIRAMRTVKTEVLRLISTWVSKSN----------------- 122  starlet sea a...
XP_001610240  765 QLMYIYPGITHLYNLYSCYIQNAVKAAGPGVLK----HNNINLMHLVRRSILHLLETYIGHLPnkiaktysepsvpiq-- 838  Babesia bovis...
5DH9_C        745 --------------------NLDD-VVKVLVEPLLNAVLEDYMN-NVPDARDAEVLNCMTTVVEKVGHMIPQGVILILQS 802  Saccharomyces...
Q23089        778 --------------------DAKL-ILDSIVPPLFDAVLFDYQK-NVPQAREPKVLSLLSILVTQLGSLLCPQVPSILSA 835  Caenorhabditi...
Q7PMB7        750 --------------------DPKM-VMENFIPPLLEAVLFDYQRtKVPNAREPLVLSTMASIVNRLQAVITPEIPKIFDA 808  Anopheles gam...
Q7RP59        244 mkneidesidvhlptveeakQINFqMTSNILNVLLETILVDYRD-SNPHIKDAEVFSLLSTVFKKIENVTCPILPTVLNY 322  Plasmodium yo...
A0D4D4        291 ------------------llNKNYqLKNSLVIPICN-LLDEYSQ-SINEQKEPELLLTFKYMLEKFLAPIEDLVPLILKG 350  Paramecium te...
XP_001327132  730 --------------------DVES-VANELIEPISQTIILEYEN-SHPLGRVPEVLSLVTSMSNKMKKVFGEVLPNIYGP 787  Trichomonas v...
XP_001645797  771 --------------------NQEE-VLNFINSEFLDVVLTDFVK-SENEVKEVEVLSCMISLVSSTNVTISDYVDKIYDA 828  Vanderwaltozy...
XP_016024187  760 --------------------DNQL-VMDNFIPPLLDAILLDYQRcKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDA 818  Drosophila si...
XP_001619023  123 --------------------DPKL-VCDNFIPPLLDAVLGDYQR-NVPGAREPEVLSTMATFINKLEANVTENVSQIFDA 180  starlet sea a...
XP_001610240  839 -----vdntvdmdqtedcnmNNYNeVLNMLIQSITSTVLVVYRN-CLAETRDHEVICVVTTLIEKLGNSGSHVLPQIFEQ 912  Babesia bovis...
5DH9_C        803 VFECTLDMINKDFTEYPEHRVEFYKLLKVINEKSFAAFLELPPAAFKLFVDAICWAFKHNNRDVEVNGLQIALDLVKNIE 882  Saccharomyces...
Q23089        836 VFQCSIDMINKDMEAFPEHRTNFFELVLSLVQECFPVFMEMPPEDLGTVIDAVVWAFQHTMRNVAEIGLDILKELLARVS 915  Caenorhabditi...
Q7PMB7        809 LFDCTLDMINKNFEDYPQHRTNFYELLQAVNMYCFKAFLSIPPEQFKLVFDSIVWAFKHTMRNVADTGLNILMQMLQNLE 888  Anopheles gam...
Q7RP59        323 VLLPTIDMIKNDFSSYPEHREKFYNFLDACVRHCFDYLFTLDSEIFNTFIQSLLWAIKHEHPSVADHGLKITHQFLHNVI 402  Plasmodium yo...
A0D4D4        351 LFDATIRLISQDFNSYPDHRINFFEFLRSCVQYHLVALFNMPQDQFKLMIDCIVWAFKHQVPNLQELGLDVLYYILQQVN 430  Paramecium te...
XP_001327132  788 IFNETLAMIKDDFSIFPEFRVPFFKFVDNIVTNYISIMLSAPDQTFSDFIETIKLGCYHTIPEVCIISLSATEHLFKSIK 867  Trichomonas v...
XP_001645797  829 IFFTTLNMIKGDLVEYPEHRIEFYKLLEQINKKYFNTLIKLSDQKFKLFIDTICWGIKHTNRDIEIRSLQIGLDLIHNIE 908  Vanderwaltozy...
XP_016024187  819 VFECTLDMINKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLD 898  Drosophila si...
XP_001619023  181 VFECTLNMINKDFEEFPEHRTNFFLLLQAVVQHCFQALLKIPPEQFKLVLDSIVWAFKHTMRNVADTGLHILYSLLKNME 260  starlet sea a...
XP_001610240  913 IFDCTLDMVKMDFHSFPEHREYFYEMLQKCTKHCFDGLLLLPSERLRAYVMSLIWAFKHEHPSVAERGLTVVREFLNNLM 992  Babesia bovis...
5DH9_C        883 Rmg----------nVPFANEFHKNYFFIFVSETFFVLTDSD--HKSGFSKQALLLMKLISLVYdnKISVPLYQeaevpqg 950  Saccharomyces...
Q23089        916 Eq-----------dDKIAQPFYKRYYIDLLKHVLAVACDSSqvHVAGLTYYAEVLCALFRAPEf-SIKVPLNDanp---s 980  Caenorhabditi...
Q7PMB7        889 Qh------------PQAAQSFYQTYYTDILMQIFSVVTDTS--HTASLQNHATILAYMFSLVEagRITVKLGPs------ 948  Anopheles gam...
Q7RP59        403 Vk-----------kKEYLDEFCKAFYYIILNEVFKTLTDSF--HKSGFHYQTIILMNLLRLLEfeVINIPEAE------- 462  Plasmodium yo...
A0D4D4        431 Sd------------AVVANQFYSLYHLRLLKDILEILTDNL--HASGFKHQSQILMILFQVASnqQITAKLSNeq----v 492  Paramecium te...
XP_001327132  868 Dt-----------nMNRYRQFLSNFYMDILVQVIKVTTDTY--HKFAFREEVNLIRKLL------STQTQQLN------- 921  Trichomonas v...
XP_001645797  909 Klg---------hnRVFSINFYRAHYLTLLSEVFYAMTDPD--HKAGFNRQSLLLMKLVSLIEngALSVSVFRnddmepr 977  Vanderwaltozy...
XP_016024187  899 Qh------------PGAAQSFYQTYFTDILMQIFSVVTDTS--HTAGLPNHAIILAYMFSLVEnrKITVNLGPi------ 958  Drosophila si...
XP_001619023  261 A-------------EEASQSFYQTYYITIVQHVLSVVTDTS--HTAGLTMHATILAHMFSLAEsgKITQPLFNssea-qy 324  starlet sea a...
XP_001610240  993 LldrrndqspggqgMSAVLSFCRNYYYLLLKEILGVLTDTL--HKSGFRLQTEILRVLIRFLEcgTVNDPSSE------- 1063 Babesia bovis...
5DH9_C        951 tSNQVYLSQYLANMLSNAFPHLTSEQIASFLSALTKQCK-D-------------------LVVFKGTLRDFLVQIKEVG 1009 Saccharomyces ...
Q23089        981 qPNIDYIYEHIGGNFQAHFDNMNQDQIRIIIKGFFSFNT-E-------------------ISSMRNHLRDFLIQIKEHN 1039 Caenorhabditis...
Q7PMB7        949 dDNVLNIQEYVAMLLKSAFSHLTGNQIKIFVTGLFNLDQ-D-------------------VHAFKEHLRDFLIQIKEVT 1007 Anopheles gamb...
Q7RP59        463 -ITKPHIIKHVQTFLTQSFENLNQKQIETFSVDMFNFCVeS-------------------PLTFRSFVRDLLISLKEFS 521  Plasmodium yoe...
A0D4D4        493 gSNLEFISQYLVNSLYNAFPNVSKQQTELHIARMFQNLN-N-------------------AHNFRQELSDYLINLKQFQ 551  Paramecium tet...
XP_001327132  922 -------GETIASAIQDLFPNRDYDSLVNYMSSLIANSN-N-------------------MVEFQHIFREFVISTTLFS 973  Trichomonas va...
XP_001645797  978 iSNHTFLIEYMSNLINNAFTQLSREQIIVFLSALTKLYD-N-------------------KKRFNGILRDFLVQSKEFG 1036 Vanderwaltozym...
XP_016024187  959 pDNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDE-N-------------------VQAFKEHLRDFLIQIREAT 1017 Drosophila sim...
XP_001619023  325 aSNQVCTACFVIDR-----SSLGEARTQDFSWGVFILGQ---------------------ARWFASA------KIKEYR 371  starlet sea an...
XP_001610240 1064 -LTRVHVMKFLVELLGNSFITLNVKQVEAFVVDLFNFAGeTiaeqnesmmssglsitsgqPMRFQTHVKDFLLSLKEFA 1141 Babesia bovis ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap