5CCB


Conserved Protein Domain Family
GCD14

?
pfam08704: GCD14 
Click on image for an interactive view with Cn3D
tRNA methyltransferase complex GCD14 subunit
GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA.
Statistics
?
PSSM-Id: 312288
View PSSM: pfam08704
Aligned: 7 rows
Threshold Bit Score: 366.431
Threshold Setting Gi: 75014110
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5CCB_A  64 GWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEK 143 human
Q86JJ0  62 GFCHVIAMTPELWSITLDHRTQILFNLDISTIIFNLELKNGSRAVESGTGSGSLSSSIARTIAPKGHLFTFEFHEERVKF 141 Dictyostelium discoideum
Q84K50  69 KFVYLLAPTPELWTLVLSHRTQILYIADISFVVMYLEVVPGCVVLESGTGSGSLSTSLARAVAPTGHVYSFDFHEQRAVS 148 thale cress
Q80XC2  64 GWVYVLHPTPELWTVNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRSVAPTGHLHTVEFHQQRADK 143 house mouse
Q6DFS3  64 GWVYILYPTPELWTLNLPHRTQILYSTDISLITMMLELKPGSVVCESGTGSGSLSHAIIRTVAPTGHLYTVEFHQQRAEK 143 tropical clawed frog
Q9VBH7  72 GWAHVLQPTPELWTQTLPHRTQIIYTPDISMIIHQLEVRPGAVVVESGTGSGSLSHYFLRALKPTGHLHTFDFHEARADQ 151 fruit fly
O14307  64 GFIYLLQPTPELWTLALPHRTQIVYTPDIALIHQKLRITYGTRVIEAGTGSASMSHAISRTVGPLGRLFTFEYHATRYQT 143 Schizosaccharomyces p...
5CCB_A 144 AREEFQEHRV---GR-WVTVRTQDVC-RSGF---GVshVADAVFLDIPSPWEAVGHAWDALk-VEGGRFCSFSPCIEQVQ 214 human
Q86JJ0 142 ARKDFKDNGL---DQ-YITVTHRDACgKEGFlrqDInnDIDAVFLDLPSPWDAIENAIAVM--HDGSMLCSFSPCIEQVQ 215 Dictyostelium discoideum
Q84K50 149 AREDFEKTGI---SS-LVTVEVRDIQ-GEGFp-eKLsgLADSVFLDLPQPWLAVPSAAKML--KQDGVLCSFSPCIEQVQ 220 thale cress
Q80XC2 144 AREEFQEHRL---SQ-WVTVHTQDVC-CSGF---GVvhVADAVFLDIPSPWEAVGHAWDALk-VEGGRFCSFSPCIEQVQ 214 house mouse
Q6DFS3 144 AIEEFRQHKV---DH-LVTVKNQDVC-KHGF---GVtgIADAVFLDIPSPWEAIGHAKSAMk-SEGGRICSFSPCIEQVQ 214 tropical clawed frog
Q9VBH7 152 ARDEFRRHGI---AD-FVTVYHRDVC-NLGFg-aELdgKADAVFLDLPAPDLAVPHAFKALk-LSGGRFCSFSPCIEQSQ 224 fruit fly
O14307 144 ALQEFREHEMlidVGgNTHLTHRDVC-KDGFldtEV--KVDAIFLDLPAPWEAIPHLSNHVnhDKSTRICCFSPCIEQIQ 220 Schizosaccharomyces p...
5CCB_A 215 RTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDL-G---------Tgtd-----------gpAGSDTSPFRSGT---- 269 human
Q86JJ0 216 NTCLKLADSKFQEIKTIEVLIRTFDTRLQEYEELNL-TnpyidnnnnN----------------NNNNNIEENRGKfeig 278 Dictyostelium discoideum
Q84K50 221 RTCEVLRS-DFIEIRTFEVLLRTYEVKEVKMDTSSMvGesheednegMrpckr------khrsnENDTVSQDNSSNassv 293 thale cress
Q80XC2 215 RTCQALAAHGFTELSTLEVLPQVYNVRTVSLPLPDL-Gannl-------------------etnMGSDASPFRSGT---- 270 house mouse
Q6DFS3 215 RTCLALEEHGFTEINTLEILLRVYDVRTINLQVADL-GraaeeksslDgtdrt------kqisaVQHGSALFKSGV---- 283 tropical clawed frog
Q9VBH7 225 RCIQELTKLGFNEIVSLEVLQQENVVKTRTLPVIDLeFlklpktdetTaatna------leskaPKEVKKYLTSSN---- 294 fruit fly
O14307 221 HSAEALRELGWCDIEMIEVDYKQWAARKSRIVHIDE-AidrlkevkrRriegferrkmrreqnlSSDAKVEDQDNDsmlg 299 Schizosaccharomyces p...
5CCB_A 270 -------------PM---------------------KEAVGHTGYLTFATK 286 human
Q86JJ0 279 gieglkkdkllskPF---------------------TEARGHTGYLTFARY 308 Dictyostelium discoideum
Q84K50 294 ---------vmarPC---------------------SEARGHTGYLTFARL 314 thale cress
Q80XC2 271 -------------PM---------------------KETVGHTGYLTFATK 287 house mouse
Q6DFS3 284 -------------PP---------------------RETVGHTGYLTFATK 300 tropical clawed frog
Q9VBH7 295 -------------P----------------------QTLPGHTGFLTFATL 310 fruit fly
O14307 300 enkssvstetalkPVtnkriregdgnyewtdvarvdSNLKSHTSYLLFAVH 350 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap