Conserved Protein Domain Family
GET2

?
pfam08690: GET2 
GET complex subunit GET2
This family corresponds to the GET complex subunit GET2. The GET complex is involved in the retrieval of ER resident proteins from the Golgi.
Statistics
?
PSSM-Id: 312275
View PSSM: pfam08690
Aligned: 31 rows
Threshold Bit Score: 162.904
Threshold Setting Gi: 121780541
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6CTY0         6 SDAEKRKLLRERRQQKFSNGgaSSRLNKITGQQQNSFLSStsv-------ldEPKVTP-----SGNKK--SSNVSDEeve 71  Kluyveromyces l...
Q2GVT9        15 raAEQARQRKARREAKIKAGa-ENRLNRITGLGGGVPRDPap---------aPAASKT-----ATATT--TPSAPVSta- 76  Chaetomium glob...
C5MBE2        12 SAEEKRRLLRERRQAKMAKGqaTDRLNNILSQGSSVKTTGvksvld-epqptAT-----------------SSAIHD--- 70  Candida tropica...
C4YCC3         5 SAEEKRKLLRERRQAKMAQGkaTDRLNNILSQGSSVKSSNvtsvld-kpekaTTTVMD-----LPSRE--TQSPTPL--- 73  Clavispora lusi...
C4R3U0         5 TEAEKRQLLREKRKAKLSQGggLDRLKKITGENNSKLSTDvp---------tKEPTAD-----ATTTA--TELPTQGlet 68  Komagataella ph...
XP_723525     12 SAEEKKRLLRERRQAKMSKGkaTARLNDILSQGSSVKTSGvksv-------------------ldqeK--EATPSHD--- 67  Candida albican...
XP_007377025  11 TEAEKRQLLRERRKAKMAKGqaSDRLNNILSQGSSVKTNVksvld--eeesvAKATSP-----SLSN------------- 70  Spathaspora pas...
XP_004200373   6 SAEEKKRILRERRQAKMSGGkaSSRLNTILSQGSSVNSEAtsvld--kttdeTKETQK-----ISPTV--EEGLNAE--- 73  Pichia farinosa...
XP_011274764   3 SEAEKRQKLRERRAAKIKNGa--SRLGKITGDYSEAQKDAetirtnplsspeTKSPTPepsigKETPI--SKSSGASkri 78  Wickerhamomyces...
XP_003657728  11 raeeqaRLRKARREAKIRAGa-ESRLKTITGLASGVPRDSppaa----tgapAASSTA-----ESAPArtTPVAGQP--- 77  Thielavia terre...
Q6CTY0        72 kstkEIQDLlsSIPGnkd---------nsETDA------A---------E----T-------------------Np---- 100 Kluyveromyces l...
Q2GVT9        77 --aaQHADP--DEVDisehfyqp---------qttarvpP---------P----D-------------------Snlsdt 111 Chaetomium glob...
C5MBE2        71 ------EDP--DIQDiseiaspppptppiGEG-------S---------P----E------------------------- 97  Candida tropica...
C4YCC3        74 -----HDDP--EVPDitsl----------------lkekE---------N----E-------------------Ap---- 94  Clavispora lusi...
C4R3U0        69 -rinAHDDPvsEIPDp------------lNEGF------D---------G----K-------------------Ep---- 93  Komagataella ph...
XP_723525     68 ----E--DP--EIQDite---------itTPPPrtppigE---------D----A-------------------Pq---- 94  Candida albican...
XP_007377025  71 ----EEDDP--EIQDitsia-----mqppISPT------P---------PigegT-------------------Pe---- 101 Spathaspora pas...
XP_004200373  74 ----SNDVF--GLVDrsalsn--kqsspvAEKL------D---------N----N-------------------Ae---- 103 Pichia farinosa...
XP_011274764  79 sqsfDHEDP--EVEDisnfe----pikesSKES------SranqpsdqlD----E-------------------Aq---- 119 Wickerhamomyces...
XP_003657728  78 ----KHADP--EEVDisq---------hfYQPR------T---------T----ArlgpssssssasnsagnisDa---- 119 Thielavia terre...
Q6CTY0       101 EVA-LFQQLLKMqqqgg---gfqngSPDASTP--D-L--FSSLLNNDTNT-TASatq----------------------- 147 Kluyveromyces l...
Q2GVT9       112 QLRqMMLGFDQPgtatp---pmpgmPGMPSPPpgM-E--DDPMMRMMMQM-LGGggnnpfgggmpgm---------pfpp 175 Chaetomium glob...
C5MBE2        98 NIDdIFQKMLQQqvqgk---dgkvdPN-------D-P--IVQIMNMFKDG-SGAdgpqegdvn----------------a 147 Candida tropica...
C4YCC3        95 DMEaMLQQILGGsgaht---gpgndGGAN-------F--LQEMMKAMAED-PSGgst----------------------- 138 Clavispora lusi...
C4R3U0        94 DLDqLIASMFnksag-----henpnSEEQGVPelMrR--FSSILQGGDSG-AAGlgaeagginpldllnslggsnigkaq 165 Komagataella ph...
XP_723525     95 DIDkIFQSMLQQqgqga-------------dtagD-P--FAQIMKMFNQV-EGGdsppsesa------------------ 139 Candida albican...
XP_007377025 102 DIDaIFNKIFQQqqqqs---gdfkeGDGN-----D-P--MANLMKMFSEG-VPEpglsratte----------------- 152 Spathaspora pas...
XP_004200373 104 DMDqLFKQILSQnsqen---gsndqN--------D-V--LSSLMRNLLDPnQANtaapgad------------------- 150 Pichia farinosa...
XP_011274764 120 QFEqMLQQMLGSvphqhqgdsnnstDAPQGTP--D-FdiFSKLLSGDANG-QGNpfgslgsmgalqqtqaqknqsqgydp 195 Wickerhamomyces...
XP_003657728 120 QLRqMMLGLDQPtp----------tSGTPAPD--T-A--DEQMLRMMMKM-LGAdpnsast------------------- 164 Thielavia terre...
Q6CTY0       148 ------mlPNFVDEKVLKYYKFKVSKLKSYIILIKWALLA--PYVYFI-------MHPN----PTvlq------------ 196 Kluyveromyces l...
Q2GVT9       176 sttpgsgaQPFPPQPQQSATNRHATLWRLLHALIALALGLy-IAVYTP-------FTGS----KLsrdsaa------aaa 237 Chaetomium glob...
C5MBE2       148 nefsndpvENKYQQDLQAYDTYQQKLWKSRFLVIRVVVTLf-NFFYHYlnv--psFHAS----NY--------------- 205 Candida tropica...
C4YCC3       139 ------aeESSYQSQLSQYHAYEQKQWKARFLVVRWIIHTl-NFVYHYias-gykLSAS----PY--------------- 191 Clavispora lusi...
C4R3U0       166 eeygstpeEIEFNKKSIAYKKHQNEVLKAKILVVRLVLILslLFVYGRdfs----------------------------- 216 Komagataella ph...
XP_723525    140 -tstqdpaELKYRQELLEYNTYNQKLWKFRFLLVRVSVTLf-NFFYHYinl--snFHAS----NY--------------- 196 Candida albican...
XP_007377025 153 kpfdqdpaIAKYQMELYEYQQYQHKLWKFRFLIIRFICTSv-NFFYHFltipdnaFRAS----SHs-------------- 213 Spathaspora pas...
XP_004200373 151 --skssekEDEYERQLVEYKKYQQSKVKFIFLVLRYLAIFi-NFTYHY-------LTSEgdsfKSss------------- 207 Pichia farinosa...
XP_011274764 196 ahpdvnleQIEYQKQLSEYNKIQNDKFKAKFMLFKFIISFg-LTIYFFgi---qgFYSS----SVe-------------- 253 Wickerhamomyces...
XP_003657728 165 --ttttspAPGTTNAPVLP-ARSTALYRLLHTLVALSLGLy-IALYTP-------FTGT----KLsrdraaaaaagsaee 229 Thielavia terre...
Q6CTY0       197 -asNLLSQIVERS----N-FFSIFTGLEIVFISIYYQMLKKLQRD----NNvtatQNAGGILKYLTMIPEGILPi-RN-I 264 Kluyveromyces l...
Q2GVT9       238 agsAEARADFGASps-qN-YFWAFATAEALLLGTRHFVADRGRSR----LQaaaaGGSGMLGMAVGFLPAG--------L 303 Chaetomium glob...
C5MBE2       206 ---SYVRDLAQDEfpvrN-FFTWFAAFEVIIVLQYYTVF---HKL----GLfhaaNQNSMIMKLMS-MGSMVLPqlNT-Y 272 Candida tropica...
C4YCC3       192 ---AFVRAQAVDShv-rT-FFTAFLTVEVAVISAYFLVM----SQ----PKfkdfSRENLVSRILS-MASAVVPavGR-Y 256 Clavispora lusi...
C4R3U0       217 -lsLFTQTYAPNGs---S-FMRVFLTLELIFQTSLFFFI---SKN----KNf---TDDSLISKLLN-IGGAFIP--AT-Y 277 Komagataella ph...
XP_723525    197 ---AYVRDLSSEKypvrD-FFTWFATTEVVLVAAYYSIF---HSL----GLfhaaNQNSFVLKAMS-MGSMVLPqlEH-Y 263 Candida albican...
XP_007377025 214 ----YVRGLVSSTp--vNtFIMWFLTIEAAILASYYFIS---SKN----GLfqtrNENSLILKGLS-LGAMVLPq-LNaI 278 Spathaspora pas...
XP_004200373 208 --yAHFRLNAPATiq-kS-FITYFITFETVILGTYFVLL---SRS----EAlkgvTESGIILKGLSLV-SLVAPkvEH-Y 274 Pichia farinosa...
XP_011274764 254 ----iFRIHKLDS----G-FSKIWLTLEILFTSYYALHLNKIQDS----HY----NYNSKILKILGYVPDMFLS--PY-Y 313 Wickerhamomyces...
XP_003657728 230 rerLYGDADTAAAt--rN-FFWVFATAEALLLTTRHLLDRGRSRLdaavAGggpnGGGSLLGLVVGFLPDGV-------- 298 Thielavia terre...
Q6CTY0       265 QGKIGLALEYFDVASMYVTDICFVLVLFGVMK 296 Kluyveromyces lactis NRRL Y-1140
Q2GVT9       304 RSKVELAMRYGEVLGSVRADVLVCVFVLGVAa 335 Chaetomium globosum CBS 148.51
C5MBE2       273 QPLVARFLGYYELFGIIFGDLSLVIVLFGLLS 304 Candida tropicalis MYA-3404
C4YCC3       257 QPLVTRALVYWNGASIFVGDLMLMVFYFGITS 288 Clavispora lusitaniae ATCC 42720
C4R3U0       278 RNLLQTASKYQVLLSMFLFDLSIVVVVFAira 309 Komagataella phaffii GS115
XP_723525    264 KPLVARFLGYYELLGIVLGDLSLVIVLFGLLS 295 Candida albicans SC5314
XP_007377025 279 KPIVARVFQYHDLVGIVLGDLALVVVYFGLLS 310 Spathaspora passalidarum NRRL Y-27907
XP_004200373 275 RPLITSLLNYAELLWMLIADVSLIVVIFGVIS 306 Pichia farinosa CBS 7064
XP_011274764 314 KNKIRWFVKYQELIHLIIFDLSVIIFLFGILS 345 Wickerhamomyces ciferrii
XP_003657728 299 RGKVELAMRYGEVLGAVRRDVLICVFVLGVAa 330 Thielavia terrestris NRRL 8126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap