1WHV


Conserved Protein Domain Family
RNA_bind

?
pfam08675: RNA_bind 
Click on image for an interactive view with Cn3D
RNA binding domain
This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN).
Statistics
?
PSSM-Id: 370054
View PSSM: pfam08675
Aligned: 12 rows
Threshold Bit Score: 121.28
Threshold Setting Gi: 321455833
Created: 4-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WHV_A         9 PDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVNTS-KYAESY--RIQTYAEY 83  house mouse
EGI63777     460 KDPNPSREHVFHLTFPKEWKHTDIIQLFIPFGGGYISWLSDTSAYVGLYRRDQAGVAMTSL-SKETVY--KIQTYTEY 534 Panamanian leafcu...
XP_008201921 422 NDPNPSREHVFHVTFPKQWKLSDLTSLFSPYGGAYVAWLSDTTAYAALHRRDQVSAVVQNL-FKSTHY--SLKKYRDY 496 jewel wasp
EFN61018     422 KDPNPSRDHVFHITFPKEWKHTDISQLFSPFGGGYISWLSDTSAYIGLYRRDQASVVMQAL-AKQTIC--KIQKYSNH 496 Florida carpenter...
O95453       438 PDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTS-KYAESY--RIQTYAEY 512 human
1_pfamImport   2 EDELPPRTHVFHVKFPKEWKTSDLVQLFQPFGSVYVAWVDDNSAFVALNKKNQANVVMRTL-TQSETY--HVQTYDSY 76 
Q7PT32       444 KEPTQTREHIFYATFPETWRTGDIQNKFKPFGPVHVSWLDNTSAFVALHNRSAASSVLKMI-GYHSGF--KVYNFAQF 518 Anopheles gambiae...
ETN61263     439 KEPTHSREHIFYVTFPETWRTGDIVGKFKPFGSVHISWLNNTSAFVSLHNRIASSSVLKTI-GYHPGF--AVHSFAQF 513 Anopheles darlingi
EDS26303     395 KEPSFSRDHIFYITFPENWRNVDILCRFRNYGQVFISWVNETSAFVTLHNRDHAAAVLKTIdKSNAAF--TICTLNQF 470 southern house mo...
Q17L86       426 KEPSFSREHVFFVSFPETWRQSDIVNRFRNYGQVYVNWVNSNSAFVTLHNRDYASHVIKTIdK--ASI--TICTLTQF 499 yellow fever mosq...
EDO42514     485 PDLKPARDHVFFLTFPSSWKYVDILDLFSPFGFVYVSWLNDVSAYVSLAVRNKSKAVLDALdVYDAPY--TITSYAEY 560 starlet sea anemone
EFX66955     441 PDLEPSREHIFYVTFPKSWKLHDIFHLFSVHGTVRVDWTGDTSAFVTLHRKENCHFVLSAMnESTLPVgcSVISYETY 518 common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap