3WJ9,5K1H


Conserved Protein Domain Family
eIF2A

?
pfam08662: eIF2A 
Click on image for an interactive view with Cn3D
Eukaryotic translation initiation factor eIF2A
This is a family of eukaryotic translation initiation factors.
Statistics
?
PSSM-Id: 400822
View PSSM: pfam08662
Aligned: 17 rows
Threshold Bit Score: 243.72
Threshold Setting Gi: 74863652
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3WJ9_B            210 KTFFKADKVQFKWNALGTSLLVLTQtEVDKSNKNYYGETNLYLLGITGQFDCRVDLDREGP-IHDVCWNADSKEFGIVYG 288  Schizosac...
Q8GUM1            403 KNLFSVSDCKMYWQSSGEYLAVKVD-RYTKTKKSTYSGFELFRIKERDIPIEVLELDNKNDkIIAFAWEPKGHRFAVIHG 481  thale cress
Q9BY44            216 KSFFKADKVTMLWNKKATAVLVIAStDVDKTGASYYGEQTLHYI-ATNGESAVVQLPKNGP-IYDVVWNSSSTEFCAVYG 293  human
Q7QCA3            192 KSFFQADKVDMMWNRKGTGLILMTStDVDTTGVSYYGKQALHYM-TPKGDSCGIQLKAEGP-IHDVAWSPKSTEFCVVYG 269  Anopheles...
Q9VNX8            232 KSFFQADRVEMLWNKRGSGLLLLTStEVDKSGASYYGNQAVHFM-ATKGDTCSVPLSKEGP-VHCVKWSPKATEFVVVYG 309  fruit fly
5K1H_B            338 RNLFNVVDCKLHWQKNGDYLCVKVD-RTPKGTQGVVTNFEIFRMREKQVPVDVVEMKET---IIAFAWEPNGSKFAVLHG 413  human
JCVI:AT1G73180.2  214 RSFFRCSSVQFSWNHGSTGLLVVVQsDVDKTNQSYYGETKLHYLTIDGTHEGLVPLRKEGP-VHDVQWSFSGSEFAVVYG 292  thale cress
Q8IJL2            358 KSFDNLDTLTCLWSISGQYLIFLVNtN-DTTNKSYGYLSNCYFCSLVSKNIHIKRINEQV--AQDVKWSNIRDEFLIIEG 434  Plasmodiu...
CDS45482          341 KKFFNSDEIKLKWNKNGTSLLLQIHtQVDKEKQSYYGSSNLYFIDTVKIKDVNI-MTNKGL-IYDTIWSYNQNKFYVCKG 418  Plasmodiu...
Q4N7W3            280 KEFDASEEGELFWNSKGTSVLFRTFaNSVKGLSSYYGANSLYLINLNNSKFKTISTVNDGI-IHDISWSQNGKDFLLLKG 358  Theileria...
3WJ9_B            289 YXPA-KTAIFDN----R----ANVVSIIPPAPRNTLIFSPNSRYILLAGFGNLQGSIDI-FDAAn-NXKKITTVEAANCT 357  Schizosac...
Q8GUM1            482 DQPRpDVSFYSMktaqNtg-rVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEF-FNVD--ELETMATAEHFMAT 557  thale cress
Q9BY44            294 FMPA-KATIFNL----K----CDPVFDFGTGPRNAAYYSPHGHILVLAGFGNLRGQMEV-WDVK--NYKLISKPVASDST 361  human
Q7QCA3            270 FMPA-RATLFNL----K----CDAVYDFEPDNRNSVFFNDFGNLVVFGGFGNLPGYIET-WDLV--RRKKLANFKAPDTT 337  Anopheles...
Q9VNX8            310 FMPS-KAALYNL----K----CDVVFDFGEGPRNCAYFNPFGNLIALAGFGNLPGAVEV-WDVS--KREKLANLKCADTT 377  fruit fly
5K1H_B            414 EAPRiSVSFYHV----KsngkIELSKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAF-VDTS--DCTVMNIAEHYMAS 486  human
JCVI:AT1G73180.2  293 FMPA-CVTIFDK----N----CKPLMELGEGPYNTLRWNPKGRVLCVAGFGNLPGDMAF-WDVV--NKKQLGSNKAEWSV 360  thale cress
Q8IJL2            435 KSDN-IILLYDH----D----LNVKCKIYSQYKNTIKWGPFGNMIALGGFGNLAGDINFyYKEVdnSVSIIKKYREACTV 505  Plasmodiu...
CDS45482          419 EIPA-DIVLHDK----N----GNIIHSYGKHKFNTLKLNYSEKLLLTGGFGNLSGDISI-WNTI--NKKEITKTKSSCAV 486  Plasmodiu...
Q4N7W3            359 PMPA-EIDLYDGv---T----GLKTLSFGKNNRNTVKRDPFDRLVLMGGFGNLRGEIDI-WDMK--TKKKISQSKSECSV 427  Theileria...
3WJ9_B            358 YCEFSPDSQFLLTAVTSpRLRVDNSIKIWHITGAPXFYEEF---NELYQA 404  Schizosaccharomyces pombe 972h-
Q8GUM1            558 DIEWDPTGRYVATSVTT-VHEMENGFTIWSFNGNMVYRILK---DHFFQL 603  thale cress
Q9BY44            362 YFAWCPDGEHILTATCApRLRVNNGYKIWHYTGSILHKYDVpsnAELWQV 411  human
Q7QCA3            338 LLEWNPAGDTFLTATTApRLRMSNGFKVWHYSGALLGEYSWa--GELLEV 385  Anopheles gambiae str. PEST
Q9VNX8            378 VFEWHPNGEWFVTATTApRLRISNGFKVYHYSGALLHETMWpqgQELLGI 427  fruit fly
5K1H_B            487 DVEWDPTGRYVVTSVSWwSHKVDNAYWLWTFQGRLLQKNNK---DRFCQL 533  human
JCVI:AT1G73180.2  361 TSEWSPDGRYFLTASTApRRQIDNGMKIFNYDGKRYYKKMF---ERLYQA 407  thale cress
Q8IJL2            506 LCDWSYDGTLFMTASTYpRMKVENVFKIYTYEGTLVNSYNF---NELYDV 552  Plasmodium falciparum 3D7
CDS45482          487 ICEFFNDDKHFLTATTHpRLRVDNNIKIFKYNGLIVSKLDF---DELYNV 533  Plasmodium berghei ANKA
Q4N7W3            428 SCEFSPDGMYFVTATTVpRMRVDCCFKIFSYSGKLVQRVDF---EELYHV 474  Theileria parva
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap