Conserved Protein Domain Family
DASH_Dad1

?
pfam08649: DASH_Dad1 
DASH complex subunit Dad1
The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro. Components of the DASH complex, including Dam1, Duo1, Spc34, Dad1 and Ask1, are essential and connect the centromere to the plus end of spindle microtubules. Throughout the cell cycle Dad1 remains bound to kinetochores throughout the cell cycle and its association is dependent on the Mis6 and Mal2.
Statistics
?
PSSM-Id: 337146
View PSSM: pfam08649
Aligned: 52 rows
Threshold Bit Score: 64.9104
Threshold Setting Gi: 598043403
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 121930147  20 YFEQQREMLVTEIAQSLELVLQNINKLNRSLEEVTQVGNEFAPVESLWSHFENVM 74
gi 380865373  24 DFERRRRLLTLQISKSMNEVVNLMSALNKNLESINGVGKEFENVASLWKEFQNSV 78
gi 68052119   15 YFERQRDQYIKNISASMEDVLNNLNALNRSLEHTVGLSQKSEELAEMWSHFYNTV 69
gi 68052175   19 YFVEQRDLLLQEITSTLDSILNNLNGLNISLENSIAVGKEFESVSELWKVFYDGL 73
gi 501755122  20 pFEQQRAHLVQQVAQTMESIITSMNQLNRNLESVISVGKEFESVSTLWRNFHDVI 74
gi 667787044  21 iFEKQRDVLIGQVAQSMEQIITNLNILNRNIESFITVGKEFESVSTLWKMFHDVL 75
gi 213404486  20 tFERKRRQLILQISNNMHEIVNLLDVLNKNLESVNGVGKEFDKVASLWMSFHESV 74
gi 444323435   9 eFIRQRAAIISEINKTMDSIINALTGVNISLESSNALRTQFESVSDLWKVFYDGL 63
gi 156844507  23 LFMEKRDLILQDITNTMDSILNNLNGLNISLESSIALGSQFESVCDLWKTFYTSA 77
gi 255712595  21 YFIEQREMILQDIGQTMDSILNNLNGLNISLENFIAVGKEFENVSELWSTFYTGI 75
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap