Conserved Protein Domain Family
ATG16

?
pfam08614: ATG16 
Autophagy protein 16 (ATG16)
Autophagy is a ubiquitous intracellular degradation system for eukaryotic cells. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. ATG16 (also known as Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate in the yeast autophagy pathway.
Statistics
?
PSSM-Id: 337127
View PSSM: pfam08614
Aligned: 111 rows
Threshold Bit Score: 115.431
Threshold Setting Gi: 545911887
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0TWI5         7 DYLSAIEARDAqEKAHEEYin-aYTKLADRTAASLAKQPASAAEdadttpTASKTIRPGTPKGKGAATVAD--------- 76  Parastagonospor...
XP_003327747   6 vIQEGLVARDAnEKAYNSIin-qYRRLAQQTAILKERNSALLKAagsiggGGSRSTAGGGDSSVARAy------------ 72  Puccinia gramin...
XP_007415481   6 aIQQALERRDAqEKAY-------NRRLAQQTTILKERNASLLKAstsvsgNGGGPNGRNQTGDISVARAYT--------- 69  Melampsora lari...
XP_006958086   8 ELRRNLLERDSkQRINESYad-nYKRLLQQYHIIKEQNDTLIKAseepstDTNLSSTNGNK---------Lqaa------ 71  Wallemia sebi C...
XP_001828915   9 vlRVRLAERNErEAVFAGIie-qYRRLAQQTKLLKERNASLLRAvntvkgNPNASTVLLastgeen-------------- 73  Coprinopsis cin...
EMD41677       9 TIRLRLVERNAkESAYASIie-qYRRLAQQTKLLKERNASLLRAmgtaraNPSSSTVFVpgsaeen-------------- 73  Ceriporiopsis s...
GAC75551      41 AIFLRLQERDVvEKQHDAMfq-qYRKLAEQTRMLKQRNRALLNAaavapsPSSASASSPAGATSGAASPSPsvtpaat-- 117 Pseudozyma anta...
CBQ69919      12 AILLRLQERDAlEKQHDAVfhhsDRKLAEQTRLLKQRNRALLNAaav------apsASAAGTSSSVATGSPtpsssssta 85  Sporisorium rei...
XP_012191302  12 AIFLRLQERDAlEKQYDAVcl-hYRKLADQTRLLKQRNRALLNAaaa------apsASTVGASTS-AADSPassaavn-- 81  Pseudozyma hube...
CCF50309      12 AIFLRLQERNAlEKQHDLIcl-qYRKLSEQTRLLKQRNRALLNAaavapsFPSSVPGSTTTTSSSSTSTSPtpstspan- 89  Ustilago hordei
Q0TWI5        77 ----------VSPPSSLAQIRAELANTQRTRSELETKLSDVNLELSALKASDSLQKQRIEQLEKAKTNLERRGKDRVDEL 146 Parastagonospor...
XP_003327747  73 ---------tASLESQLSTLRDELATVYKTQGQNAQRLLVMNEALREREERSRAEVDETRLLRVEAARLRERVASHAEVM 143 Puccinia gramin...
XP_007415481  70 ----------ASLEAQLATLRDEMTGMYKTQSQNAQRLLVMNETLRERDERSRAEEEELRLVRTEVARLRERVANHAEAM 139 Melampsora lari...
XP_006958086  72 --------lvHSLQQQLHSTRDELTNLYKGQNQSSQRLLEMNETLRERDDNLRAIEAENLSLKASVSRLSKAREDDVEGK 143 Wallemia sebi C...
XP_001828915  74 ---pvqaayiSSLESQISSLRDELATVYKTQSQNSQRLLSMNETLREKEELIRIEAESHRRAKEELAVVKKKVDQHNELM 150 Coprinopsis cin...
EMD41677      74 ---pvraayiASLESQISSLRDELATVYKTQGQNAQRLLAMNETLREKEELSRVDSENLRKAREEIATLRRKVDQHNELM 150 Ceriporiopsis s...
GAC75551     118 ---svqlayiTSLEQQLASLRDEVATLYKTQGQNAQRLLLMNESHREKEDEARRQSELLAKLQIDHEKLRRQADDLTHAV 194 Pseudozyma anta...
CBQ69919      86 aanpvqlayiTSLEQQLSSLRDEVATLYKTQGQNAQRLLLMSESHREKEEEARRQSEALAKLQLDHEKLKRQADDLGHAV 165 Sporisorium rei...
XP_012191302  82 ---pvqlayiTSLEQQLSTLRDEVALLYKNQGQNAQRLLLMSESHRDKEEEARRQTETLAKLQLDHEKLRRQADDLSHAV 158 Pseudozyma hube...
CCF50309      90 ---pvqvayiTSLEQQLSSLRDEIATLYKTQGQNAQRLLLMSESHRTQEEEFRNQTESLAKLQLEHEKLERQAEDLTHTI 166 Ustilago hordei
Q0TWI5       147 KGKGKFVEDIQDEMVALTLQLNMAEQEKQKLKKENDDLTKRWVQKMEEEAKRMN 200 Parastagonospora nodorum SN15
XP_003327747 144 REKERNVQILQDELSTLQLEYTQQEQKIKDLKSDNANLLQRWLDKVHEEAVRMN 197 Puccinia graminis f. sp. tritici CRL 75-3...
XP_007415481 140 KEKDRQIQSVLDELATLQLEHSVLQETNTKLRQDNAGLVQRWLDQRLAEATRMN 193 Melampsora larici-populina 98AG31
XP_006958086 144 RERERGMEALQDEITTLRLELEQIEIRNQNLKNDNAALIQRWLDRMNQEADKMN 197 Wallemia sebi CBS 633.66
XP_001828915 151 AEKDRTVQILHDEISTLQLELGQIEERNQTLSRDNAKLLQRWLDAKQAEANRMN 204 Coprinopsis cinerea okayama7#130
EMD41677     151 AEKDRTAQILHDEISALQLELSQIEERNQTLTKDNAKLLQRWLDAKQAEVNRMN 204 Ceriporiopsis subvermispora B
GAC75551     195 GEKDRGIQILQDELATLSLEVSQIEARNQDLKKDNASLLQRWLDRMNQEADRMN 248 Pseudozyma antarctica T-34
CBQ69919     166 GEKDKGIQILQDELATLSLELSQIEARNQDLKKDNASLLQRWLDRMNEEADKMN 219 Sporisorium reilianum SRZ2
XP_012191302 159 GEKDRGIQILQDELATLSLELSQIEARNEDLKKDNASLLQRWLDRMNEEADKMN 212 Pseudozyma hubeiensis SY62
CCF50309     167 GEKDRGMQILQDELATLSLELSQIEARNEDLKKDNASLLQRWLDRMNEEAEKMN 220 Ustilago hordei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap