3VP8


Conserved Protein Domain Family
Tup_N

?
pfam08581: Tup_N 
Click on image for an interactive view with Cn3D
Tup N-terminal
The N-terminal domain of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor.
Statistics
?
Aligned: 54 rows
Threshold Bit Score: 95.6607
Threshold Setting Gi: 528318081
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3VP8_A                11 KLNELLDAIRQEFLQVSQEANT-YRLQnQKDYDFKMNQQLAEMQQIRNTVYELELTHRKMKDAYEEEIKHLKLGLEQRD 88   Sacchar...
WGS:AACS:CC1G_08510   49 RLNESLEAIKAEFEAMATEIEL-TKNQ-KDEVEVKLGAQVSELNHIRRALYDLEAQHTKVRQQYEDELARLRAELAAat 125  Coprino...
EDR08098              32 RLVDTLDIIKQEFEAMTSEIES-IQSQ-KDDLESKVASQLSELNVIRRSLYELESQHGKTRQLYEEELSRLRLELAatq 108  Laccari...
EFI93780              30 RLDEHLDLIRQDYEIMATELTD-ARAQ-KEELETKVVAQINEIALITNTLHELNSKHARLRQTYEQEVTALRAQLHEAQ 106  Schizop...
ESK90844              21 RLNESFEVIRQEFDLLAQEVAA-SRNQ-RDDYEAKVASQVNELNIIRQSIYELEAQHGKVRQQYEEELSRLRAEIHAlr 97   Monilio...
EPS93362              30 KLNECFETIRQEFDAVAHELVH-LRGQ-RDDLDNKVNGQVNELNIIRQSLYDLETQHGKIRQQYEQEIAALRAEVlalr 106  Fomitop...
EMD35275              33 RIGEAFEIVRQEFDVLAGEINN-LRGQ-RDDYENKVTGQVNELNIIRQSLYDLETQHSKIRQQFEDEVRALRAEVHALr 109  Gelatop...
WGS:AACS:CC1G_08590  202 RLNENFDVVRQEFEMLNAELGL-VRNQ-RDEFEAKVQSQVNELNIIRQALYDLESQHGKVRQQFEEELARVRAELHvak 278  Coprino...
EKD02774              35 RVKECFEIIQNEFEAVAKDNNShWQVQ-REEYEL----QSDELGLIRKTLYDLEAAHGKIRAEYEAEIARLRRELEARG 108  Trichos...
Q5KGF2                31 RLNELFDLIRQEYETLGTDGNI-WKQQ-RDEYEAKVQSQINELGMIRQSLYELEANHAKIRQEYETEIARLRRELESRG 107  Cryptoc...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap