2EBD,1UB7,4DFE,1HN9,1ZOW,4RYB,4X9O,2X3E,1HZP,5BQS,4EWP,3H76,3GWA,5DWZ


Conserved Protein Domain Family
ACP_syn_III_C

?
pfam08541: ACP_syn_III_C 
Click on image for an interactive view with Cn3D
3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal
This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III EC:2.3.1.41, the enzyme responsible for initiating the chain of reactions of the fatty acid synthase in plants and bacteria.
Statistics
?
PSSM-Id: 337099
View PSSM: pfam08541
Aligned: 166 rows
Threshold Bit Score: 75.9955
Threshold Setting Gi: 81719219
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EBD_A       226 KPEEVSLVIPHQANVRIINA-LAEKLNIPKEKVFVNI-QKYGNTSAASIPIALHEAIKEGKVKRGDLILMTAMGGGLTWG 303 Aquifex aeolicu...
Q8RC85       256 TPSDIGYLAILHMKRSAHEF-ILNELGLSPDKS-IYL-ENYGHMGQIDQILSTHLALEEGKIKDGDVVVWVSAGIGYVWD 332 Caldanaerobacte...
Q67MB7       260 RPEEIRFVGMLHTKRSLFDQ-VMAALGIPPERQ-VYL-DEYGHMSAIDPLVALYEAERRALLAPGDLAVLLSAGTGYTWA 336 Symbiobacterium...
Q81RV7       249 TPKDIKVLLPLHTKRSMLIE-LIQGLGLTEEQV-VYL-DHYGHMSALDPCIGLHFANEQGKLQAGDIAVVVSAGTGYTWA 325 Bacillus anthracis
Q82HI7       258 RPSDITRVTHVLSGGPEYIRaVLEPLGIDPARGVLDFgRHLGHMTTSDQLAALHHLVETRQVVEGDRVLMINNSFGVSLF 337 Streptomyces av...
Q82PP5       249 GVEDISRVVMPLIHRGVSPE-NYELLGFTEKQSTWDLgRLVGHVAAGDQFLGLEHLVKQGTVGPGDLVLLVAAGEGFSYS 327 Streptomyces av...
Q7NZW4       234 SLAEVRYLLINHGDEDMHRS-LLARLDLSEERTVFNY-HRLGHMGSADTLIALEQLEREQQLQAGDLILLASSAMGFSWG 311 Chromobacterium...
WP_010983812 245 KLGDIDWYVLPNLGRTRMRAqYFDPFGIDPQRSTWSWgRRVGHLGAGDQFAGLAHLVSEGALEPGQTCLLAGVGAGFTWT 324 Streptomyces av...
EST35520     248 DARDIKTVVIHSMPRQAAAS-YLKILGFSLESSTWEFsRTTGHLGAGDHLAALHHLLSTGKVGPGDNLLLCGSSPGVTYK 326 Streptomyces ro...
Q9L1V9       252 EPGDVTRVCHVFTGQESYLKvILDPMGLSPDQGLLDFgRNLGHMTVNDQIVGLTHLVETGQVGPGDHVLIVAHGGGVSIT 331 Streptomyces co...
2EBD_A       304 AVLLRY 309 Aquifex aeolicus VF5
Q8RC85       333 AITIKW 338 Caldanaerobacter subterraneus subsp. tengcongensis
Q67MB7       337 ATAIRW 342 Symbiobacterium thermophilum
Q81RV7       326 ATVIRW 331 Bacillus anthracis
Q82HI7       338 GAVVEI 343 Streptomyces avermitilis
Q82PP5       328 AAVVEI 333 Streptomyces avermitilis
Q7NZW4       312 ITAVEY 317 Chromobacterium violaceum
WP_010983812 325 AGILEI 330 Streptomyces avermitilis
EST35520     327 AAVIRI 332 Streptomyces roseochromogenes subsp. oscitans DS 12.976
Q9L1V9       332 CAVVRI 337 Streptomyces coelicolor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap