2WYA,2P8U,2F82


Conserved Protein Domain Family
HMG_CoA_synt_C

?
pfam08540: HMG_CoA_synt_C 
Click on image for an interactive view with Cn3D
Hydroxymethylglutaryl-coenzyme A synthase C terminal
Statistics
?
PSSM-Id: 337098
View PSSM: pfam08540
Aligned: 10 rows
Threshold Bit Score: 397.999
Threshold Setting Gi: 21542411
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WYA_A 176 LALERGLRGTHMENVYDFYKP--NLASEYPIVDGKLSIQCYLRALDRCYTSYRKK--IQNQWkqa-gsDRPFTLDDLQYM 250 human
P54871 183 IPIDRQFSACHMKNTWDFFKPitPIPSEYPVVDGSLSLSSYLEAVRMTYTYFISK--VNRHT------TGIDGLNSFDGV 254 Caenorhabditis elegans
P17425 187 VIFDRGLRGTHMQHAYDFYKP--DMLSEYPVVDGKLSIQCYLSALDRCYSVYRKK--IRAQWqke-gkDKDFTLNDFGFM 261 Norway rat
P54874 176 IVFEPGLRGTYMQHAYDFYKP--DLTSEYPYVDGHFSLECYVKALDGAYANYNVRd----VAkn--gkSQGLGLDRFDYC 247 Schizosaccharomyces p...
Q5A3Z7 178 IVFD-SIRGSFMEHAYDFYKP--DFTSEYPVVDGHFSLSCYVKAVDNCYKNYSKK-----ITgd--anKTVGVYDHFDFS 247 Candida albicans
P54839 217 IVFD-SVRASYMEHAYDFYKP--DFTSEYPYVDGHFSLTCYVKALDQVYKSYSKKaiSKGLVsdpagsDALNVLKYFDYN 293 Saccharomyces cerevis...
P54873 175 IVFESKLRASHMAHVYDFYKP--NLASEYPVVDGKLSQTCYLMALDSCYKHLCNK--FEKIE------GKEFSINDADYI 244 thale cress
P54868 224 LALERGLRGTHMENVYDFYKP--NLASEYPIVDGKLSIQCYLRALDRCYTSYRKK--IQNQWkqa-gsDRPFTLDDLQYM 298 human
2P8U_A 195 LIFERGLRGTHMQHAYDFYKP--DMLSEYPIVDGKLSIQCYLSALDRCYSVYCKK--IHAQWqke-gnDKDFTLNDFGFM 269 human
2F82_A 174 IVFESKLRGSHMAHVYDFYKP--NLASEYPVVDGKLSQTCYLMALDSCYKHLCNK--FEKLE------GKEFSINDADYF 243 Brassica juncea
2WYA_A 251 IFHTPFCKMVQKSLARLMFNDFLS-ASSDTQTSLYKGLEAFgglkl--edtytNKDLDKALLKASQDMFDKKTKASLYLS 327 human
P54871 255 FLHSPFTKMVQKGLAVMNYTDSQLrHKQLNGNGVDHKLDEN------------DRAGLAKMIELSAQVWKEKTDPYLVFN 322 Caenorhabditis elegans
P17425 262 IFHSPYCKLVQKSLARMFLNDFLNdQNRDK-NSIYSGLEAFgdvkl--edtyfDRDVEKAFMKASAELFNQKTKASLLVS 338 Norway rat
P54874 248 IFHAPTCKQVQKAYARLLYTDSAAePSNPELEGVRELLSTLdakk-----sltDKALEKGLMAITKERFNKRVSPSVYAP 322 Schizosaccharomyces p...
Q5A3Z7 248 AFHVPTCKLVTKSYARLLYNDYVSnPS--KFADLIDETTRKhidgltydesltDKILEKTFVGLAKDETKKRVQPALQVP 325 Candida albicans
P54839 294 VFHVPTCKLVTKSYGRLLYNDFRAnPQ--LFPEVDAELATRdyde-----sltDKNIEKTFVNVAKPFHKERVAQSLIVP 366 Saccharomyces cerevis...
P54873 245 VFHSPYNKLVQKSFARLLYNDFLRnASS-IDEAAKEKFTPYssltl--desyqSRDLEKVSQQIAKPFYDAKVQPTTLIP 321 thale cress
P54868 299 IFHTPFCKMVQKSLARLMFNDFLS-ASSDTQTSLYKGLEAFgglkl--edtytNKDLDKALLKASQDMFDKKTKASLYLS 375 human
2P8U_A 270 IFHSPYCKLVQKSLARMLLNDFLNdQNRDK-NSIYSGLEAFgdvkl--edtyfDRDVEKAFMKASSELFSQKTKASLLVS 346 human
2F82_A 244 VFHSPYNKLVQKSFARLLYNDFLRnASS-IDEAAKEKFTPYsslsl--desyqSRDLEKVSQQLAKTYYDAKVQPTTLVP 320 Brassica juncea
2WYA_A 328 THNGNMYTSSLYGCLASLLshHSAQELAG-SRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDklVSSTsdlpKRL-ASRK 405 human
P54871 323 RRIGNMYTPSLFAQLLAYL--AADDCVTGeKSILFFAYGSGLASAIFPGRVRQTSNLDKIRQvaIRAI----KRL-DDRI 395 Caenorhabditis elegans
P17425 339 NQNGNMYTSSVYGSLASVLaqYSPQQLAG-KRIGVFSYGSGLAATLYSLKVTQDATPGSALDkiTASLcdlkSRL-DSRT 416 Norway rat
P54874 323 TNCGNMYTASIFSCLTALLsrVPADELKG-KRVGAYSYGSGLAASFFSFVVKGDVSE-------IAKKtnlvNDL-DNRH 393 Schizosaccharomyces p...
Q5A3Z7 326 TNTGNMYTASAWVSLASLLyyVGSDNLKN-KRISIFSYGSGLASTLLSVTVKGDVSA-------ITKVldfdYKLgDGRK 397 Candida albicans
P54839 367 TNTGNMYTASVYAAFASLLnyVGSDDLQG-KRVGLFSYGSGLAASLYSCKIVGDVQH-------IIKElditNKL-AKRI 437 Saccharomyces cerevis...
P54873 322 KEVGNMYTASLYAAFASLIh-KKHNDLAG-KRVVMFSYGSGSTATMFSLRLNDNKPPFSISN--IASVmdvgGKL-KARH 396 thale cress
P54868 376 THNGNMYTSSLYGCLASLLshHSAQELAG-SRIGAFSYGSGLAASFFSFRVSQDAAPGSPLDklVSSTsdlpKRL-ASRK 453 human
2P8U_A 347 NQNGNMYTSSVYGSLASVLaqYSPQQLAG-KRIGVFSYGSGLAATLYSLKVTQDATPGSALDkiTASLcdlkSRL-DSRT 424 human
2F82_A 321 KQVGNMYTASLYAAFASLVh-NKHSDLAG-KRVVMFSYGSGSTATMFSLRLCENQSPFSLSN--IASVmdvgGKL-KARH 395 Brassica juncea
2WYA_A 406 CVSPEEFTEIMNQREQFYHKVNFSPPGD--TNSLFPGTWYLERVDEQHRRKYARR 458 human
P54871 396 QFTPEEFTETLQKREVFLRSKEIPKSPS--ETSLFPNTYFLDNMDKLYRRSYTLH 448 Caenorhabditis elegans
P17425 417 CVAPDVFAENMKLREDTHHLANYIPQCS--IDSLFEGTWYLVRVDEKHRRTYARR 469 Norway rat
P54874 394 CLTPTQYEEAIELRHQAHLKKNFTPKGS--IERLRSGTYYLTGIDDMFRRSYSVK 446 Schizosaccharomyces pombe 972h-
Q5A3Z7 398 IQSPEDYLAAIELREKAHLQKSFKPQGS--TDNLSQGTYYLTEIDDKFRRAYAIK 450 Candida albicans
P54839 438 TETPKDYEAAIELRENAHLKKNFKPQGS--IEHLQSGVYYLTNIDDKFRRSYDVK 490 Saccharomyces cerevisiae S288c
P54873 397 EYAPEKFVETMKLMEHRYGAKDFVTTKEgiIDLLAPGTYYLKEVDSLYRRFYGKK 451 thale cress
P54868 454 CVSPEEFTEIMNQREQFYHKVNFSPPGD--TNSLFPGTWYLERVDEQHRRKYARR 506 human
2P8U_A 425 GVAPDVFAENMKLREDTHHLVNYIPQGS--IDSLFEGTWYLVRVDEKHRRTYARR 477 human
2F82_A 396 EYAPEKFVETMKLMEHRYGAKEFVTSKEgiLDLLAPGTYYLKEVDSLYRRFYGKK 450 Brassica juncea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap