4IWY


Conserved Protein Domain Family
RimK

?
pfam08443: RimK 
Click on image for an interactive view with Cn3D
RimK-like ATP-grasp domain
This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK.
Statistics
?
PSSM-Id: 312072
View PSSM: pfam08443
Aligned: 4 rows
Threshold Bit Score: 272.457
Threshold Setting Gi: 62906875
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4IWY_A 117 ARDKLRSXQLLARQG--------IDLPVTGIAHSPDDTSDLIDXVg---GAPLVVKLVEGTQGIGVVLAETRQAAESVID 185 Escherichia coli K-12
P45241 105 ARDKWKSLQLLLKAG--------IPVPNSLLSGGEVQAQATIPHI----SSPTILKTLNGSQGIGVILAEKPQSAVSIME 172 Haemophilus influenza...
Q58407  94 TSDKFKCIKLLAKNK--------IKTPKTALIRDYEDAVKFIEKYn--lRFPVVIKNSFSKCGLKVFMARNYDELKQL-- 161 Methanocaldococcus ja...
P75097  90 ADNKALSHAVLAQHPtikqiptlIGPQNFRLAWYPEKLEQFIEQIkrcfQFPVIVKSIYGSFGDYVFLCKDEQKLRQTLS 169 Mycoplasma pneumoniae...
4IWY_A 186 AfrgLNAHI----LVQEYIKEAQG---CDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIAIKAAR 258 Escherichia coli K-12
P45241 173 AfkqTNISM----LQQDFIEEAGN---ADIRCFVIGDQVVATMQRIGQNGEFRANCHRGGKTEKITLSDEEKQIAIQATK 245 Haemophilus influenza...
Q58407 162 ----TKNAIwegkLIQEFIDFKENdlyRDMRILVVDGEVVGGYRRVSRD--FRTNLYLGNVVEKLNIDEELEELALKCAD 235 Methanocaldococcus ja...
P75097 170 G---LTEQI----IVQQYIATSNS---EAVRVIVVNNQVVGALHTQ-NEGDFRSNLNKGAVGEPYQLSQEETKLAITISQ 238 Mycoplasma pneumoniae...
4IWY_A 259 TXALDVAGVD-ILRANRGPLVXEVNASPGLEGIEKTTGIDIAGKXIRWI 306 Escherichia coli K-12
P45241 246 AIGLDVAGVD-LIRSKKGLLVLEVNASPGLEMIEKTSGIDIAAEIIDYI 293 Haemophilus influenzae Rd KW20
Q58407 236 LSEAVILGVD-ILPTKDNYYVIELNSSPGTKGF-RDIGINADKKIAEAL 282 Methanocaldococcus jannaschii DSM 2661
P75097 239 AMQLFYCGIDfLFDQDRSLIFCEVNSNVQLTKSSMYLKTNLAIQLLASI 287 Mycoplasma pneumoniae M129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap