5JZC


Conserved Protein Domain Family
Rad51

?
pfam08423: Rad51 
Click on image for an interactive view with Cn3D
Rad51
Rad51 is a DNA repair and recombination protein and is a homolog of the bacterial ATPase RecA protein.
Statistics
?
Aligned: 23 rows
Threshold Bit Score: 329.247
Threshold Setting Gi: 20178063
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5JZC_A    84 MGFTTATEFHQRRSEIIQITTGSKELDKLL-QGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDT 162 human
Q95Q25   138 MGFTTGAEVHVKRSQLVQIRTGSASLDRLL-GGGIETGSITEVYGEYRTGKTQLCHSLAVLCQLPIDMGGGEGKCMYIDT 216 Caenorhabditis elegans
EDO81751 140 PGFMSGVVALERRQRIRRISTGCSDLDALL-GGGIESMAITEVFGEFRSGKTQLCHTIAVTAQLD------GSRVAYLDT 212 Giardia lamblia ATC...
Q6CKB7    73 IGFIPATLQWQIRQAVMSISTGSKQFDSVL-GGGIMTMSITEVFGEFRCGKTQLSHTLCVTAQLPKELNGPEGKVAYIDT 151 Kluyveromyces lactis
Q5ARI8    80 SGFITAMELSHQRKRVVRISTGSKQFDSIL-GGGFQSMSISEVFGEFRCGKTQLSHTMSVVAQLPKDMGGAEGKVAYIDT 158 Aspergillus nidulans
O61128   108 VGFITGSSCLQQRSTLLRISTGSTALDQLLgGGGIESRSITEAFGEFRTGKTQIGHTLCVTCQLPLEMGGGNGKAVYVDT 187 Leishmania major
Q5CYN2    87 SSFQSGSEVMSRRQNILRITTGSEQFDKML-MGGFESMCITEIFGENRCGKTQICHTLCVAAQLPLEMNGGNGKVCFIDT 165 Cryptosporidium parvum
Q7GBF7    90 QGFMTGSDLLIKRKSVVRITTGSQALDELL-GGGIETLCITEAFGEFRSGKTQLAHTLCVSTQLPIHMHGGNGKVAYIDT 168 Japanese rice
Q9XED7    85 LGFTSASQLHAQRLEIIQLTTGSRELDQIL-DGGIETGSITEMYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKALYIDA 163 Zea mays
Q6Q242    87 MGFTTAAAVAEQRKEVISITTGCKELDTIL-EGGIETGSITEIYGEYRCGKTQLCHTLCVTCQLPVEMGGGEGKAMYIDT 165 Chlamydomonas reinh...
5JZC_A   163 EGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQ 242 human
Q95Q25   217 NATFRPERIIAIAQRYNMDSAHVLENIAVARAYNSEHLMALIIRAGAMMSESRYAVVIVDCATAHFRNEYTGRGDLAERQ 296 Caenorhabditis elegans
EDO81751 213 EGTFRPEKIGPIAERYKLDPTTTLSRIAYARAYTHEQQIELLAAAAEQMSEKKFALLIIDSLTALFRVDFTGRGELADRQ 292 Giardia lamblia ATC...
Q6CKB7   152 EGTFRPERIKQIAQGYDLDPEVCLENISYARALNSEHQMELLEQLGEELSSGEYRLLIVDSIMANFRVDYSGRGELNERQ 231 Kluyveromyces lactis
Q5ARI8   159 EGTFRPERIGQIAERFGVDPDSAKENIAYARALNSEHQLELLNTLSKEFVGGEYRLLIIDSIMNCFRVDFCGRGELADRQ 238 Aspergillus nidulans
O61128   188 EGTFRPERIRPIAERFGMDSNSVLDNILVARAYTHEHQAHLLSMVAAKMAEDQFSLLVVDSITALFRVDFSGRGELAERQ 267 Leishmania major
Q5CYN2   166 EGTFRPERIVKIAERFGVQGDVALDNIMYARAYTHEHLNQLISAAAGKMIEEKFALLIVDSIIALFRTEFSGRGELAERQ 245 Cryptosporidium parvum
Q7GBF7   169 EGTFRPERIVPIAERFGMDANAVLDNIIYARAYTYEHQYNLLLGLAAKMAEEPFRLLIVDSVIALFRVDFSGRGELAERQ 248 Japanese rice
Q9XED7   164 EGTFRPQRILQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMVETRFALMVVDSATALYRTDFSGRGELSARQ 243 Zea mays
Q6Q242   166 EGTFRPQRLSQIAERYGLAPEDVLNNVAYARAHNTEHQMRLLQEAAGMMADSRFSLVVVDSATALYRTEFNGRGELSIRQ 245 Chlamydomonas reinh...
5JZC_A   243 MHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAA-MFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLP 321 human
Q95Q25   297 MKLSAFLKCLAKLADEYGVAVIITNQVVAQVDGGAsMFQADAKKPIGGHIIAHMSTTRLYLRKGKGENRVAKMVQSPNLP 376 Caenorhabditis elegans
EDO81751 293 QKLGQHLASLAKLADEFNIAIFVTNQVMAQVDG-AaMFTADPKKPIGGHILAHASTTRLYLRKGRGNNRVAKIYDSPSLP 371 Giardia lamblia ATC...
Q6CKB7   232 QKLNQHLSRLNRIAEENNIAVFMTNQVQSDPGASAlFASADGRKPVGGHVLAHASATRILLRKGRGDERVAKLQDSPDMP 311 Kluyveromyces lactis
Q5ARI8   239 QKLNQFLMKLAHMAEEFNVCVLMTNQVQSDPGASAlFSGADGRKPVGGHVLAHASTTRVLLRKGRGEERVAKIQDSPDCP 318 Aspergillus nidulans
O61128   268 QKLAKMLSQLIKIAEEFNIAVYITNQVVSDPGG-AsMFVADPKKPVGGHILAHASTTRLSLRKGRGDQRVCKIFDSPSLP 346 Leishmania major
Q5CYN2   246 QILNKTLSKLNKLADQFNIAIVMTNHVMADPAG-GmSFMPNVAKPVGGHVIGHASHVRLSLRKGKGEQRVCKVYGSPHLP 324 Cryptosporidium parvum
Q7GBF7   249 QKLAQMLSRLTKIAEEFNVAVYITNQVIADPGGg--MFITDPKKPAGGHVLAHAATIRLMLRKGKGEQRVCKIFDAPNLP 326 Japanese rice
Q9XED7   244 MHLAKFLRSLQKLADEFGVAVVITNQVVAQVDG-AaMFAGPQIKPIGGNIMAHASTTRLFLRKGRGEERICKVISSPCLA 322 Zea mays
Q6Q242   246 ILLGRFLRALQNIADEYGVAVVVTNQVVANPDGAGaMFAGPQTKPIGGNIMAHATTTRLSVRKGRGENRVVKIIASPSLP 325 Chlamydomonas reinh...
5JZC_A   322 EAEAMFAINADGVGDA 337 human
Q95Q25   377 EAEATYSITNHGIEDA 392 Caenorhabditis elegans
EDO81751 372 EAEATFAVGEQGVCDA 387 Giardia lamblia ATCC 50803
Q6CKB7   312 EKECVYVIGERGIMDS 327 Kluyveromyces lactis
Q5ARI8   319 EREATYLITNGGIDDP 334 Aspergillus nidulans
O61128   347 ELECVYSISEQGIIDA 362 Leishmania major
Q5CYN2   325 ESECVIQLSDGGIIDP 340 Cryptosporidium parvum
Q7GBF7   327 EGEAVFQVTSGGIMDA 342 Japanese rice
Q9XED7   323 EAEARFQISSEGVTDV 338 Zea mays
Q6Q242   326 EREANFAIGQEGVTDA 341 Chlamydomonas reinhardtii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap