1SZP


Conserved Protein Domain Family
Rad51

?
pfam08423: Rad51 
Click on image for an interactive view with Cn3D
Rad51
Rad51 is a DNA repair and recombination protein and is a homolog of the bacterial ATPase RecA protein.
Statistics
?
PSSM-Id: 312056
View PSSM: pfam08423
Aligned: 22 rows
Threshold Bit Score: 330.405
Threshold Setting Gi: 20178063
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SZP_D        63 MGFVTAADFHMRRSELICLTTGSKNLDTLL-GGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGKCLYIDT 141
gi 75019452  138 MGFTTGAEVHVKRSQLVQIRTGSASLDRLL-GGGIETGSITEVYGEYRTGKTQLCHSLAVLCQLPIDMGGGEGKCMYIDT 216
gi 74690023   73 IGFIPATLQWQIRQAVMSISTGSKQFDSVL-GGGIMTMSITEVFGEFRCGKTQLSHTLCVTAQLPKELNGPEGKVAYIDT 151
gi 74680480   80 SGFITAMELSHQRKRVVRISTGSKQFDSIL-GGGFQSMSISEVFGEFRCGKTQLSHTMSVVAQLPKDMGGAEGKVAYIDT 158
gi 74959767  108 VGFITGSSCLQQRSTLLRISTGSTALDQLLgGGGIESRSITEAFGEFRTGKTQIGHTLCVTCQLPLEMGGGNGKAVYVDT 187
gi 74778750   87 SSFQSGSEVMSRRQNILRITTGSEQFDKML-MGGFESMCITEIFGENRCGKTQICHTLCVAAQLPLEMNGGNGKVCFIDT 165
gi 75230461   90 QGFMTGSDLLIKRKSVVRITTGSQALDELL-GGGIETLCITEAFGEFRSGKTQLAHTLCVSTQLPIHMHGGNGKVAYIDT 168
gi 75127395   87 MGFTTAAAVAEQRKEVISITTGCKELDTIL-EGGIETGSITEIYGEYRCGKTQLCHTLCVTCQLPVEMGGGEGKAMYIDT 165
gi 910271658  92 SSFITANELVQKRSKVLKITTGSTVFDQTL-GGGIESMCITELFGENRCGKTQVCHTLAVTAQLPKSLNGGNGKVCYIDT 170
gi 159118412 140 PGFMSGVVALERRQRIRRISTGCSDLDALL-GGGIESMAITEVFGEFRSGKTQLCHTIAVTAQLD------GSRVAYLDT 212
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SZP_D       142 EGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDFSGRGELSARQ 221
gi 75019452  217 NATFRPERIIAIAQRYNMDSAHVLENIAVARAYNSEHLMALIIRAGAMMSESRYAVVIVDCATAHFRNEYTGRGDLAERQ 296
gi 74690023  152 EGTFRPERIKQIAQGYDLDPEVCLENISYARALNSEHQMELLEQLGEELSSGEYRLLIVDSIMANFRVDYSGRGELNERQ 231
gi 74680480  159 EGTFRPERIGQIAERFGVDPDSAKENIAYARALNSEHQLELLNTLSKEFVGGEYRLLIIDSIMNCFRVDFCGRGELADRQ 238
gi 74959767  188 EGTFRPERIRPIAERFGMDSNSVLDNILVARAYTHEHQAHLLSMVAAKMAEDQFSLLVVDSITALFRVDFSGRGELAERQ 267
gi 74778750  166 EGTFRPERIVKIAERFGVQGDVALDNIMYARAYTHEHLNQLISAAAGKMIEEKFALLIVDSIIALFRTEFSGRGELAERQ 245
gi 75230461  169 EGTFRPERIVPIAERFGMDANAVLDNIIYARAYTYEHQYNLLLGLAAKMAEEPFRLLIVDSVIALFRVDFSGRGELAERQ 248
gi 75127395  166 EGTFRPQRLSQIAERYGLAPEDVLNNVAYARAHNTEHQMRLLQEAAGMMADSRFSLVVVDSATALYRTEFNGRGELSIRQ 245
gi 910271658 171 EGTFRPEKVCKIAERYGLDGEAVLDNILYARAFTHEHLYQLLAISAAKMCEEPFALLVVDSIISLFRVDFSGRGELSERQ 250
gi 159118412 213 EGTFRPEKIGPIAERYKLDPTTTLSRIAYARAYTHEQQIELLAAAAEQMSEKKFALLIIDSLTALFRVDFTGRGELADRQ 292
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SZP_D       222 MHLAKFMRALQRLADQFGVAVVVTNQVVAQVDG-GMAFNPDPKKPTGGNIMAHSSTTRLGFKKGKGCQRLCKVVDSPCLP 300
gi 75019452  297 MKLSAFLKCLAKLADEYGVAVIITNQVVAQVDGgASMFQADAKKPIGGHIIAHMSTTRLYLRKGKGENRVAKMVQSPNLP 376
gi 74690023  232 QKLNQHLSRLNRIAEENNIAVFMTNQVQSDPGAsALFASADGRKPVGGHVLAHASATRILLRKGRGDERVAKLQDSPDMP 311
gi 74680480  239 QKLNQFLMKLAHMAEEFNVCVLMTNQVQSDPGAsALFSGADGRKPVGGHVLAHASTTRVLLRKGRGEERVAKIQDSPDCP 318
gi 74959767  268 QKLAKMLSQLIKIAEEFNIAVYITNQVVSDPGG-ASMFVADPKKPVGGHILAHASTTRLSLRKGRGDQRVCKIFDSPSLP 346
gi 74778750  246 QILNKTLSKLNKLADQFNIAIVMTNHVMADPAG-GMSFMPNVAKPVGGHVIGHASHVRLSLRKGKGEQRVCKVYGSPHLP 324
gi 75230461  249 QKLAQMLSRLTKIAEEFNVAVYITNQVIADPGG--GMFITDPKKPAGGHVLAHAATIRLMLRKGKGEQRVCKIFDAPNLP 326
gi 75127395  246 ILLGRFLRALQNIADEYGVAVVVTNQVVANPDGaGAMFAGPQTKPIGGNIMAHATTTRLSVRKGRGENRVVKIIASPSLP 325
gi 910271658 251 QKLNKTMSILSKLSEQFNIAILITNQVMSDPGA-TMTFIANPMKPVGGHVIGHASTIRLSLRKGKGDQRVCKVYDAPNLP 329
gi 159118412 293 QKLGQHLASLAKLADEFNIAIFVTNQVMAQVDG-AAMFTADPKKPIGGHILAHASTTRLYLRKGRGNNRVAKIYDSPSLP 371
                        250
                 ....*....|....*.
1SZP_D       301 EAECVFAIYEDGVGDP 316
gi 75019452  377 EAEATYSITNHGIEDA 392
gi 74690023  312 EKECVYVIGERGIMDS 327
gi 74680480  319 EREATYLITNGGIDDP 334
gi 74959767  347 ELECVYSISEQGIIDA 362
gi 74778750  325 ESECVIQLSDGGIIDP 340
gi 75230461  327 EGEAVFQVTSGGIMDA 342
gi 75127395  326 EREANFAIGQEGVTDA 341
gi 910271658 330 EVECIFQLSDKGVIDA 345
gi 159118412 372 EAEATFAVGEQGVCDA 387
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap