Conserved Protein Domain Family
FAE1_CUT1_RppA

?
pfam08392: FAE1_CUT1_RppA 
FAE1/Type III polyketide synthase-like protein
The members of this family are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species. The region featured in this family contains the active site residues, as well as motifs involved in substrate binding.
Statistics
?
PSSM-Id: 337037
View PSSM: pfam08392
Aligned: 23 rows
Threshold Bit Score: 410.861
Threshold Setting Gi: 75291026
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6K558        43 VLRRRRR-PVYLLNYSCHLPDVDRKVNLEVCEYFGQRCRHY-SDDTADFMRLIYRKSGLGQETYAPPFIFSGEFQ--K-- 116 Japanese rice
Q75M74        23 AAARRRQsRCYLLDYVCHKPSDDRKVSTEAAGAVIERSKRL-SLPEYRFLLRVIVRSGIGEETYAPRNVLDGREGe-P-- 98  Japanese rice
Q6K3E6        23 AAARRRRaTCYLLDYACHKPSDDRKVTTELAGAIIERNKRL-GLPEYRFLLKVIVNSGIGEHTYSPRNVLDAREDc-P-- 98  Japanese rice
Q9FW59        25 ARSRRRR--CYLLDYVCYKATDDRKLPTDLCGEIIQRNKLL-GLEEYKFLLKVIVNSGIGEETYGPRNIIGGGDArpD-- 99  rice
Q9LQP8        23 IDSKRDQ-NCYILDYQCHKPSDDRMVNTQFSGDIILRNKHL-RLNEYKFLLKAIVSSGIGEQTYAPRLFFEGREQr-P-- 97  thale cress
Q8LQT7        61 VRARRAR-GVYLVEYGCFRPRPCYRAPFATCLEHAHLMPYLvDEESVAFAIRLLERSGLGDETCVPDAYHYMPPD--R-- 135 Japanese rice
Q5Z6S3        79 YLVMRPR-AVYLVDYACFRTAPNCRVPFATFLEHARQVPTL-TERSVRFMTRLLERSGLGEETCLPPAHHYIPTY--Kyc 154 Japanese rice
Q9C992        38 YYFFKPRcIIYLIDFSCYQPPDFLRAPVSNFIEHLTISGVF-DQESLDLQQKILERSGISDDASVPATVHEIPPN--A-- 112 thale cress
Q9FH27        42 YQRIRTRvKVYLLDFTCYRAPDSNRVPMSTLIETIYLDDKL-DQESIDFQARILERSWLSNQTSIPRSLMEIPLK--K-- 116 thale cress
XP_015642269  79 RLVRRPH-SVYLVDYACFRPQPSNRLPFATFAEHFRLSPHI-DDGSFRFVTRMMERSGLGERTYVPRGNLYLPPR--T-- 152 Japanese rice
Q6K558       117 TQAFAVQEAEEGLFATVAHLLAKS------DVRPRDVGFVVVACSMFSPAPSLASMIVRRFGMPPGTRTYSLAGMGCSAG 190 Japanese rice
Q75M74        99 THGDSLGEMEDFFGDSIAELFART------GFGPRDVDVLVVNASMFSPDPSLASMIVHRYGMREDVAAYSLAGMGCSAG 172 Japanese rice
Q6K3E6        99 TLRDALDEMDDFFDDAVAAVLARA------AVSPRDVDLLVINVGSFSPSPSLADRVVRRFGLRDDVMAYNLSGMGCSAG 172 Japanese rice
Q9FW59       100 RLAEGMEEMDETFHAVLDELFARSsaagggGVRPADVDLLVVNVSMFSPAPSLSARVVRRYNLREDVKVYNLTGMGCSAT 179 rice
Q9LQP8        98 TLQDGLSEMEEFYIDTIEKVLKRN------KISPSEIDILVVNVSMLNSTPSLSARIINHYKMREDIKVFNLTAMGCSAS 171 thale cress
Q8LQT7       136 SLRASRDESELVIFSAVDDVFARS------ALTPADIDVLIVNCSIFTPTPVFADMVVNRYKLRAEVQNVNLSGMGCSAG 209 Japanese rice
Q5Z6S3       155 TLEAARAEVDLVVFSAVDELFAKT------GVSPDDVDILVVNCSLFCPTPSFVDMIVNRYKLRSDIRSMHLSGMGCSAS 228 Japanese rice
Q9C992       113 SISAAREETHEILFAIVQDLFSKH------EIDPKSIDILVSNCSLFCPSPSITSMIINKFGMRSDIKSFSLSGMGCSAG 186 thale cress
Q9FH27       117 SLSSVKIETMTTIFTSVEDLLRKN------KLSPRSIDILITNCSLHSPSPSLSAMVINKFHMRSNIKSFNLSGMGCAAG 190 thale cress
XP_015642269 153 GMEEARDEAEIVVFAAVGDLLART------RIRPEEIDVLVTNCSVFSPTPSFADMVVNRFKLRGDVRAVHLSGMGCSAG 226 Japanese rice
Q6K558       191 TVGIDMAARALR-VSRrGGYALVVVTENMSLNWYFGENKHMLVTNCIFRVGSAAALVTD--VAARRGDAKYELVRTLRTH 267 Japanese rice
Q75M74       173 LISLDLARNTLA-TRP-RALALVVSTESIAPNWYTGTDKSMMLANCLFRCGGASVLVTN--DPVLRGRAKMELGCLVRAN 248 Japanese rice
Q6K3E6       173 LVSVDLARNVML-TRP-RTMALVLTSESCAPNWYTGTDKSMMLGNCLFRCGGAAALLTN--DPAFRSRAKMELRCLVRAH 248 Japanese rice
Q9FW59       180 LIALDLVNNFLR-THA-NKVALVMTSESIAPNWYAGNKRSFMLGNCLFRSGGCAYFLTN--DPRHRRHAKLRLRHLVRTH 255 rice
Q9LQP8       172 VISIDIVKNIFK-TYK-NKLALVVTSESLSPNWYSGNNRSMILANCLFRSGGCAVLLTN--KRSLSRRAMFKLRCLVRTH 247 thale cress
Q8LQT7       210 LVSVGLAKNLLQ-VSPpGTNVLIVSTEILSSQYYVGTERAMLLPNCLFRMGAAAMILSN--SPDH---ARFRLGRVVRTV 283 Japanese rice
Q5Z6S3       229 LISIGLARNLLQ-VAPhGARALVVSTETITPNYYVGNERAMLLPNCLFRMGGAAALLST--SPA---KARFRLKHVVRTL 302 Japanese rice
Q9C992       187 ILSVNLVKDLMK-IHG-DSLALVLSMEAVSPNGYRGKCKSMLIANTIFRMGGAAILLSN--RKQDSHKAKYKLQHIIRTH 262 thale cress
Q9FH27       191 ILSVNLANDLLQ-AHR-GSLALIVSTEALNTHWYIGKDRSMLLTNCLFRMGAAAVLMSS--NDHDRDNAKYELLHVVRKN 266 thale cress
XP_015642269 227 LIAVEVARNLLQaAAPrGAHALVVSTETTSFSHYAGTSRSMLLPTALFRMGGVAMLLSTsrSSATTTTSRFRLAHIVRTL 306 Japanese rice
Q6K558       268 HGGDDAAYNAAVQMEDEEGNVGVALTKDLVRVAGAGLRQHIATLAPHVLPVSELLRYVWR--VARAY 332 Japanese rice
Q75M74       249 IAANDDAHACALQREDDDGTVGISLSKALPKAAVRAFAANLRRLAPRILPITELARFAAQllITKKL 315 Japanese rice
Q6K3E6       249 IGAHDDAHAAAVHREDADGRLGVSLSKALPKAAVRAFTENLQRLAPRILPAGELARFAARllL-RKL 314 Japanese rice
Q9FW59       256 TGASDDAYSCALQMEDDAGRPGFHLGKDLPRAAVHAFVKNLRLLAPRVLPLPELLRLAFAtfLSSGR 322 rice
Q9LQP8       248 HGARDDSFNACVQKEDELGHIGVHLDKTLPKAATRAFIDNLKVITPKILPVTELLRFMLCl-LLKKL 313 thale cress
Q8LQT7       284 TAARDSDYRCVFQEEDEQGNTGIRLSKDLATTAGHALKSNIAAFGPLVLPASEQLLVAISf-LKRKL 349 Japanese rice
Q5Z6S3       303 TGAEDSAHHCVFQEEDEHGSIGINLSKDLMTIAGNALKANITAIAPLVLPASEQLKFALAf-IARKA 368 Japanese rice
Q9C992       263 VGSDTESYESVMQQVDEEGKVGVALSKQLVRVASKALKINVVQLGPRVLPYSEQLKYIISf-IQRKW 328 thale cress
Q9FH27       267 KAKDDRAYRCIYQDIDSDEKQGVSITKDVISVAGDMLKMNLTSLGPLVLPYLEQFQYVIQhiLCKKL 333 thale cress
XP_015642269 307 NAAEDRAYRCAYHEEDGDGNLGVNLSKDIVPVAGEMLKANIATVGSRVLPLSEKLLYALSl-LARKV 372 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap