3RYT,5V6R,4M8N


Conserved Protein Domain Family
Plexin_cytopl

?
pfam08337: Plexin_cytopl 
Click on image for an interactive view with Cn3D
Plexin cytoplasmic RasGAP domain
This family features the C-terminal regions of various plexins. Plexins are receptors for semaphorins, and plexin signalling is important in path finding and patterning of both neurons and developing blood vessels. The cytoplasmic region, which has been called a SEX domain in some members of this family, is involved in downstream signalling pathways, by interaction with proteins such as Rac1, RhoD, Rnd1 and other plexins. This domain acts as a RasGAP domain.
Statistics
?
Aligned: 61 rows
Threshold Bit Score: 557.54
Threshold Setting Gi: 0
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3RYT_A          48 GIPFLDYRTYAMRVLF-----------PG----IEDHPVLkeMEV--------QANVE-K-SLTLFGQLLTKKHFLLTFI 102  house mouse
CBY24850      1393 TMPFREYRSFILHFMFp----------PNdeenRHYHRELcpFGTqn----srSGTIDrSmGLQEFRKLLGQREFLLVFI 1458 Oikopleura d...
3_pfamImport     1 --------EYITQVLF-----------NQ----RSGHPVLdeNAMv------gQGTVK-QdALKSLLSVIKNKDVLLVLV 50  
EGD75945      1444 eahprpfGEYARRVYF-----------TA----LDTHPLPvrPRFpgt-----------ndCIEQFTFFLQQDDFLRAFV 1497 Salpingoeca ...
EEC14243       956 GIPTLDHRTYVMKVFF-----------PG----VYDHPLL--QDNklkn-ngiYSNYE-V-AMSQFQQLILNKSFLVTFI 1015 black-legged...
EFV60023      1212 GIPYRSRIDFINRVLF------------K----EEHRSVLqmSTVkrfskienSATVQ-N-ALIHFEQLLMNRQFVVSWV 1273 Trichinella ...
O45657        1194 GPELINFPHFVENLLW-----------------SDNNLTSapSLArtl-----------pvTLAQFHALLSFKGFIFTIV 1245 Caenorhabdit...
EGT44270       956 qPEIVDFSRFMENLLW------------------AENTLTvpILArtl-----------pmALAQFHALLSFKEFIFTIV 1006 Caenorhabdit...
26_pfamImport    1 GVPFVNALDYSKNMLFaglavlppttdPEy----------------------mNSDLE-T-AMIMFSRQLGNPDFLTNFI 56  
24_pfamImport    1 GMPFVSGADYIRNMLFwglkvqpmtndPEl----------------------pQESIK-Q-AMSEFSKLLNRKEFLMQYI 56  
3RYT_A         103 RTLEAQR-SFSMRDRGNVASLIMTAL--QGEMEYATGVLKQLLSDLIEKNLeSKnHPKLLLRRTESVAEKMLTNWFTFLL 179  house mouse
CBY24850      1459 KTLESHP-KFTTRDRSKFAAFLMISL--QGKLEYATLILQYLIIDMIEKMP--ShNLGTLFRHSNTIGEKMLSYWFAMLM 1533 Oikopleura d...
3_pfamImport    51 RTLEEQR-KFTVQEKGNMASLLTICL--FDDLPYYTRVMLELLTGLIQKHV-SR-NPKLLLRRSESVVEKMVSHWLSINL 125 
EGD75945      1498 GVMEGEGrAFSVRDRCQVASLLMCSA--NGDEAMGTHTLSTLLDQYFTAn--SRrDPRLMLRRTESVAEKLLTAWLTTGM 1573 Salpingoeca ...
EEC14243      1016 NTLESQK-SFTIRDRVNVASLLMIIF--MGRLEYGTDVLRTLLLQLIEKSVnTK-HPQLMLRRTESVVEKMLTNWLALSM 1091 black-legged...
EFV60023      1274 RTLEGQS-SFAAPDKVYVGSLLTAAL--MNNMQYLTEVVIALLRQLIARAGlEK-HPQVMLRRTESVVEKMLANWIALCL 1349 Trichinella ...
O45657        1246 EAAESDV-SISTSEKSMLASLLISVL--LRNFSYCTEVVVDLLRAHIARSVqNK-RAELLFRNSDSVVEKMFSKWMSICL 1321 Caenorhabdit...
EGT44270      1007 DVAESRN-SISTSEKSMLASLLISVL--IRNFSYCTEIVISLLKTHIAKAVeNK-RAELLFRNSDSLVEMMISKWWCICL 1082 Caenorhabdit...
26_pfamImport   57 KQLEEQR-KPKRRDRVNIASLITALLvtEGKFGYFTETLFKLLEESIEEGA-ESgRARSLFRRTETIVEKLLSNWISLCM 134 
24_pfamImport   57 QGLDEAK-NLKQKDRVNIASLLSTILttEGRFHYLTDVMLTLMAEKIEESD-EN-RLKQLFKSVGSILEKLISNWVALCM 133 
3RYT_A         180 YKFL-KECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQ-IDYKTLTLNCVNpe----heNAPEV--PVK 251  house mouse
CBY24850      1534 YRTV-YRRTGEHIFNLFKKLKDLVHSEPVDQITGHSRMTLSEQYLLRVInINTNQLSITVLHhe----ggEPQFI--QIS 1606 Oikopleura d...
3_pfamImport   126 YDECiNEQAGKPLFLLTKAVHYLVSSAPCDVIAKKAFNSLNEMTLLGTE-LQYETVVLHATIvee--ggkVTTSV--DVK 200 
EGD75945      1574 HDAV-LRDAARPLYNLTQALKIYAWKGPVDAVTGAATYTLNADALLRER-VEYEPLTLHVDM--------NRQVY--EVH 1641 Salpingoeca ...
EEC14243      1092 YDYL-RDYAGSSLFLLFSAIKHQVEKGPVDTITYDARYSLFEARLLREQ-VDYELVTIQVIQe------dQDEKV--HCR 1161 black-legged...
EFV60023      1350 YEYL-QGPSGSSLFLLFKALKHQTEKGPVDAVTFDARYSLSEDRLLKEQ-IDYETLYFKIIPpklgdnatPTETV--ICR 1425 Trichinella ...
O45657        1322 YSHL--TPQMNSYFYLYKALQYQTDKGPVDAVTGDARYTINEAKLLRES-VDTKTLKIRVIPfe-----kCDESI--DLE 1391 Caenorhabdit...
EGT44270      1083 YPSL--KPQMNSFYNLYKALQFQTDRGPVDAVTGDARYTINEANLLREC-VETRTIIVNVIPle-----nCHDTV--RLE 1152 Caenorhabdit...
26_pfamImport  135 YQYL-KRQVAESLYLLYQSIKIQVEKGPIDITTGQSVFSLNFECLLEEE-VEFNELTLSVVGr------dKHHKY--YVK 204 
24_pfamImport  134 YKHL-QKQVAYPLYVLYQAIKGQVDKGPVDAITGQAHFSLNFDYLLDED-VEFEDVTLQIVD--------KEHKVleQVK 203 
3RYT_A         252 GLNCDTVTQVKEKLLDAVYKGVPYSQRPKAGDMDL-----EW-RQGRMA--RIILQDE-DVTTKIDND--WKRLNTLAHY 320  house mouse
CBY24850      1607 GLYCDTVDQIKERILDTIYWDVEYSKRDSVADYDL-----EYvDNSLKVplRRLMKNV-DSSSEIKDG--LRRLNTVEHY 1678 Oikopleura d...
3_pfamImport   201 VVNVDSIKQAKTKIIEAVYKDKPYSECPKPDDLDF-----ALmNSSEST--GITLSDV-DGMSVVDGK--YTKINTLKHY 270 
EGD75945      1642 VNSCDTIGQILEKL-----KLVVTTAGADVSDFDTrvlvlQR-EEG-----LRVLKDI-DDSSKMSAG--WVQLNTASFY 1707 Salpingoeca ...
EEC14243      1162 VNDCDTISQVKSKILDTLYKNTPFSLRPSIYDVDL-----EW-RHGRGG--HLILADE-DLTTKTVSG--WRQINTLRHY 1230 black-legged...
EFV60023      1426 VLSCDSIRQLKSKILDCLYKNTAFSSRPTVHDIDL-----EW--HGHIG--VVLLREHpHLQTRRSDG--WIRLNTVRDY 1494 Trichinella ...
O45657        1392 VHACDAICQVKQKVASAVYRETPYSQRPRITQFEL-----KY-KCPKRG--DVKLTDV-LPIETLSQKklPVKLFTLADY 1462 Caenorhabdit...
EGT44270      1153 LHSCDAIRQVKQKVAAAVYYKTPYSQRPRITQFDL-----RF-KCPRQG--EIRLVEF----RTLSKKklPVKLLTISDY 1220 Caenorhabdit...
26_pfamImport  205 VLDVDCMTQVKQKILDAAYRNSHIVQQNRAHEMDL-----LWyHPGGE---ERILKDR-DELNKTIGNtkGLFINTVKTY 275 
24_pfamImport  204 VLDVDTITQAKQKILDAVYCKRQTAQQLRSNEVDL-----VL-LNGCMG--RLVLKDR-DPITETRGH--WIKANTIKAY 272 
3RYT_A         321 Q---VTDGSSV----ALvpkqtsaynisnsstftkslsryesm--------------------------lrtasspdslr 367  house mouse
CBY24850      1679 QklfLPNAKKL----DFtdkrylelkpststtmlgqshqsgsslsrsrin------------vsehpsssnmtgtmgrsg 1742 Oikopleura d...
3_pfamImport   271 N---VPDNAVV----VLrphdvenqvipsriwqnkcrfpsfy-----------------------------flnklilai 314 
EGD75945      1708 G---MRDGDQL----AFvksdtdggdarrrrnnnssssgggg----------------------------ggggggslfk 1752 Salpingoeca ...
EEC14243      1231 G---VKDSAVM----SLvmkqndsfssnckysnvs------------------------------------------lns 1261 black-legged...
EFV60023      1495 R---LPNQAVI----VVvlrsssysg------------------------------------------------------ 1513 Trichinella ...
O45657        1463 G---ISDGCTLemspAVytaesyrnsladsgqs----------------------------------------------s 1493 Caenorhabdit...
EGT44270      1221 D---VQDGSILemtpAFyalenhsqsiadsetl----------------------------------------------s 1251 Caenorhabdit...
26_pfamImport  276 G---VSDGCQV----ALivkssmnetgtyqpvtpgvqlfqqyq---------------------------ehagpddvrd 321 
24_pfamImport  273 K---ISNGSSV----AIvkkqdgtnpefsaplvldkaelaytyvprflesyspwstdknhtqyvklnaleapavnnvrts 345 
3RYT_A         368 srtpmitpdlesgtkLWHLVK----NHD-HLDQre------------------------gDR----GSKMVSEIYLTRLL 414  house mouse
CBY24850      1743 tplhgeivrdgrqiiDYHHVYdg------------------------------------iSS----RKMAAPDHFTLTMI 1782 Oikopleura d...
3_pfamImport   315 vfkedvsspllppkhMYHLVN--------DTLQkhffskkacvitaviallrkkademldNL----MKRPFQEMFLTRMV 382 
EGD75945      1753 vrtksksridpmacePWHLVK----PDT-DGTAaa-----------------------aaAA----ATRVPSEIFLTYLM 1800 Salpingoeca ...
EEC14243      1262 mspivshcdleqgikYWHLVK----PED-ETIGqp------------------------kDM----HYKAIPEIFLTRLL 1308 black-legged...
EFV60023      1514 -------ytdfsthtCWHLIR----P---DGTSnr-----------------------rnGG----TPSRITEIYLTRLL 1552 Trichinella ...
O45657        1494 wssldrcspiyssskYYHLTN----PSSgTMTFkk-----------------------ksSNdsnlLPKSIPEVYLTRLL 1546 Caenorhabdit...
EGT44270      1252 ctsvdinspaysfleHYHLVK----STSgSLMCrp-----------------------ksSTd---VPKSIPEVYLTRLL 1301 Caenorhabdit...
26_pfamImport  322 rdyirirtmesggsrIMHLVAenqmPTE-SSTS---------------------------------LTKLDREFLAPRLL 367 
24_pfamImport  346 weytqidvdpeegkqMWHLVK--------DESNtvnsn-----------------skkkrPHkidhRPKLIKEVYTSRLL 400 
3RYT_A         415 ATK-------------------GTLQKFVDDLFETIFSTahrGSALPLAIKYMFDFLDEQADKHQIHDS-DVRHTWKSNC 474  house mouse
CBY24850      1783 RAK-------------------ESLETPIQVLIESIVSVvdrQYQMPMCIKYMFDFLDDEFQKVEQRHP-DTIHKWKTNS 1842 Oikopleura d...
3_pfamImport   383 KAK-------------------TTIQEYVDGVFNSILR----PKPISKTVRYFFQFLDREADRHKINDP-EVLHIWKTNS 438 
EGD75945      1801 TVK-------------------TALQPFVDDLVDAVFNI----DQPSPAVRFLFHFLDDQARKHNISDP-RTTHIWKSNA 1856 Salpingoeca ...
EEC14243      1309 STK-------------------GTVEKFVEDFLKTILTV---NEALPPAIKWLFDLLDEAAHRYGIVDP-EVPHAWKSNC 1365 black-legged...
EFV60023      1553 STK-------------------GTVQQFVDDFITSTLAVe--QSTFPAPIKYLFDLLEEEAARLPVADPgSVAQAWKNNS 1611 Trichinella ...
O45657        1547 TSK-------------------GTVETYVEDFLESVLYMh--DSSYPPILKFFFDILDREASVNGVSE--NICQQWKANG 1603 Caenorhabdit...
EGT44270      1302 TSK-------------------GTVEAYIEDFFESVLYMh--AYKFPPILKYVFDTLDHEAEINEVED--NISHQWKANG 1358 Caenorhabdit...
26_pfamImport  368 VTKvgklnalsqdlsfqavfmyKTIQTRLDEFLACVFKR---PAETPLTIKYLFDFFDKMANKYCDDKPeEIAEAWKSNS 444 
24_pfamImport  401 VTK-------------------NAVQPFLDEFLEATFSLpegQSSLPVHIKHLFDFFDTHAEEHSEIKD-NVSAAWKTNS 460 
3RYT_A         475 LPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHK--LGKDSPSNKLLYAKDI-PNYKSWVERYYADIA 551  house mouse
CBY24850      1843 LFLRYWVNLIKNPEFLFDINKSPAVSNSLTVVAQTLIDGCSTTESDplLAQAQSTSKVLFSKSVhNNFREWVQSYFEEVR 1922 Oikopleura d...
3_pfamImport   439 LLLRYWVNVLKNPEFVFDLNKTDIVDSCLNVITQAFMDACTTTNRK--LGHDSPSNKLLYAKDA-DNYKVMVKEFFINIS 515 
EGD75945      1857 FPLRFWINLIKNPDFLLHVQQTRTVSSGLSTVAQVIMDSCSVSDQQ--LGKHSPANKHLYRKEV-AEYKQKIANFYTAIS 1933 Salpingoeca ...
EEC14243      1366 LPLRFWVNFIKNPDFILDVQKTPIVDSCLSVIAQTLMDACSTCEHR--LGKDSPSNKLLFAKDI-PKYRRKVLEFYQSIA 1442 black-legged...
EFV60023      1612 LPLRFWVNIIKNPDFIFDVEKTITVDSCLSVIAQMFMDACSSSEPQ--LGKDSPSNKLLFARDL-PRYRAAFGRFYNDIR 1688 Trichinella ...
O45657        1604 YVLRVWANFVRNPQLVFDVPHSISMDANLSTVAQTMMDCFSFSEPV--LGAHSPSSRLLFAKDV-ARLRPLSVDLFKRVK 1680 Caenorhabdit...
EGT44270      1359 FVLRVWANFIKNPQLALDLPHSISMDANLSIIAQTMIDCFSFSEPV--LSAQSPSSRLLFAKDV-ARLRPFSADLLKRIK 1435 Caenorhabdit...
26_pfamImport  445 LPLHYWMTTLTHPSYVFDMRQSRSADQSVSVLANMLDNACKKIRSE--NTQESALNRVLFYRDL-PGHIRTIGEYYENIK 521 
24_pfamImport  461 LALRYWVTAISHPSFIFDMQQSRTADYCINVLTNMLDHACKKNIPT--YNLDASLNRILYRPEL-PRYIEMVEGYYNAIA 537 
3RYT_A         552 KMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIAKYKDE 595  house mouse
CBY24850      1923 MREEIPRDDFILFLREENELHMHDFNKNFAIRELFNYAKEYYND 1966 Oikopleura dioica
3_pfamImport   516 NTPTVTQEEVTQILQKQSASYASRFNQMVALNGIYEHLVKYREQ 559 
EGD75945      1934 RLPPPTDAELQASFASAQSGEQAC-DRPDAVCGLMEYALRFREQ 1976 Salpingoeca rosetta
EEC14243      1443 LQPKVTDQEMCAAMQALSLAHSSEFEPSGAVKELYVYAAKYREQ 1486 black-legged tick
EFV60023      1689 HLPTVTDQELNSLMAPLSSLYSQQWNTNGALRELFLYSLRYQDQ 1732 Trichinella spiralis
O45657        1681 NSPPLGMDELRTELVNMANDVSTCKGSSLALSELLSWVRGNGIR 1724 Caenorhabditis elegans
EGT44270      1436 NFPSLSINELEIEL-----DLSTYKGSSLALSELLSWVRGNAIR 1474 Caenorhabditis brenneri
26_pfamImport  522 GLPPPTTEELQEDFNRITQDFSGLFSRVATLSKLYDFTS----- 560 
24_pfamImport  538 DLPGVSQSQLEEASQQITKEFSAHFSRLGMLHQLYEYTKEHTD- 580 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap