Conserved Protein Domain Family
Spc7

?
pfam08317: Spc7 
Spc7 kinetochore protein
This domain is found in cell division proteins which are required for kinetochore-spindle association.
Statistics
?
PSSM-Id: 336997
View PSSM: pfam08317
Aligned: 56 rows
Threshold Bit Score: 225.188
Threshold Setting Gi: 754401559
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5B2K9        984 PEFEPIHLQDFLNMTNIHF--ME-L-----TTTK--RRHTTAPDSISKraarlslegDGKSSASNFDDCVAAGFCTVPML 1053 Aspergillus n...
Q6CMN2        359 SQSGPISLQTFFDAANIKF--NV-DtqineFQID--LKSTNNIEHVPS------------------NIIYQALYCKIPIL 415  Kluyveromyces...
Q754X4        438 EPVEPISLQMFLDTTGISFv-IDlD------GVQ--NYDPITFTYTDR------------IEDISTRQIYDALYLQIPLL 496  Eremothecium ...
CCE78174      689 EAYSPVTLYDFLRDISIRF--YD-Dl---eIGTKqvDRISLSLTKIN------------ENEDWPFDDYVEAMN-KIPLL 749  Pichia farino...
XP_003644801  427 EAIEPISLESFLDATGVSF--LI-D-----LQII--EK--IEKIEFRY---------TEDITKVSTAQIYNALYLQIPIL 485  Eremothecium ...
XP_007377455  578 edyePIKLSQFLQDIGIQF--YD-D-----------RELDLNSFPRFS---------NPDQSNITMTDYISSIP-KLPVL 633  Spathaspora p...
XP_001647283  372 kEFQSYSIKEFLKEINISF--KI-Dn---eVGNS--DESTLNFTLIDP---------A-QITGIRINQLYNTYYVDIPIL 433  Vanderwaltozy...
XP_003687472  375 lESNRHSIKDFLRELNLDFdqYN-T-----VSGE--EKQDIIFKLSQ----------LSETNGVPINQLYNFFYIDTPIF 436  Tetrapisispor...
XP_013933112  427 DDYVHVTLPQFLNQVQVQF--YD-N-----IGPS--ERELTVT--------------SEGSGSQALHKYVDA-VTEFPNF 481  Ogataea parap...
XP_011271529  512 deyaPVPLKQFLEDLGVEF--FD-N-----LNIN--EDFTVVLNQIEN---------NTEVKKI---DYLKAKSIKIPWL 569  Wickerhamomyc...
Q5B2K9       1054 ELYQHSCRELKSYISEGRQIIRSIETETYAD-NPPL-FREYMAAAPDIRLL-MDNQFRNVKTHTRLLSKATWYEWRMKLL 1130 Aspergillus n...
Q6CMN2        416 EIQAFTAKELTRRILQSRNLLKSLREQIASNePPRL-IKEYFEADTDTRYA-INEKLELVTIMARLQSEKVWFEWRSQHL 493  Kluyveromyces...
Q754X4        497 EIYAFIVKELHRRILDSQRLFQELEEQISNNpPPYL-FRNYFESSDEVKQL-MKEQIVLIKSFARLEAKKVWFEWRCQHL 574  Eremothecium ...
CCE78174      750 ELYDFSCKELSKNINEGKTMFEQFDDVTREN-NPKL-FREYYSAGPNEQLG-MKSEFQLIKDFARQQSKEVWYSWRTQLV 826  Pichia farino...
XP_003644801  486 EIYSFIVKELYRRIHDSQELFHEVQEQISNN-SPPLlFRSYFESSDEVKKL-MNEQIVLIKSFARMEAKKVWLEWRCQHL 563  Eremothecium ...
XP_007377455  634 QLYEFSNSELNKNLMDTRNLFNAFNTHIEMN-NPTM-FRQYYKSDEQAQAQ-MNQRFARVREYMRQSSHKKWYEWRYNMI 710  Spathaspora p...
XP_001647283  434 EMNTFISKELLRRISQSKVLFEDLEERVIKE-SPPLlFREYFSSEAEIKNI-AKSQLQLVKKYSSLEAKKAWYEWRIQHL 511  Vanderwaltozy...
XP_003687472  437 EMNTFIITELLKKISNSKSILDDLDNQTISN-PPPI-IAEYYASDLSHKQS-ISQKMLTIKNYSGLLAQRGWYEWRIQHL 513  Tetrapisispor...
XP_013933112  482 DYFYHLIAQRKSGIDRSQRSINDFSEAIINN-NPTS-VREFYESTDEVQKD-LKVNYQALASLARTIAEHGNLVFMTNSL 558  Ogataea parap...
XP_011271529  570 ELYSFSCSELQKDMSKLKLFLDNYNDEFIEE-NPQL-VREYYQIRDTQEQRrLSDSLLLMKTLSDKEAEVSWLEWSYQLL 647  Wickerhamomyc...
Q5B2K9       1131 EGLKEGLDRHVEEMKGDDNLLSKHEAILKDAMPALSAKHSSLKEEAAQLQQ-----LADELENC-D-QDELWNARGKLSD 1203 Aspergillus n...
Q6CMN2        494 KGIKTVLEENIAILVDENAQIMKYMNEINDVKIRVSDIKQVLMKELDVLRQhn-dvFSNKKENI-TtLLKVNKLKGDLRE 571  Kluyveromyces...
Q754X4        575 KGIKSVLEENLSLVQTEYAEVVARLNEISDIKHRLQALEQSLRHELELLRNge-kpMR--VTTL-AdRLKIEKIKSELKA 650  Eremothecium ...
CCE78174      827 QNLFDQLGDKYDLLLQDKDILQDSLSTINELFDEITAKKNLLMQRLTSFES-----FESQCDSI-T-DDDLESMQKELES 899  Pichia farino...
XP_003644801  564 KGIKSVLEENLSLVQTEYAGVVKHLNEINDIKDRVKTIEQTLMRELQTLKNgg--pVVRHGSSIaE-RMKIEKLKRELSD 640  Eremothecium ...
XP_007377455  711 SALLDKSRERYSELVNDRQCLISDIDQLQKLRLKFHGYLQQLRRRLTDLKQ-----VTSQIGKI-P-AGELEKLSIELKS 783  Spathaspora p...
XP_001647283  512 VGIKNVLIENLSILKEEFEKVNTDLENIQEIKNKVESLKDRIRQEIKLIRElp-pdYYQNHPNLkD-KLRLEQLKQELVS 589  Vanderwaltozy...
XP_003687472  514 LGLQNVLQENITILNEELEKISEDLENVKNIKNRTDSIRASIRREIRLLKElpaakYNKESTLN-D-KINIENLKQELMA 591  Tetrapisispor...
XP_013933112  559 EGLLKSYENRKASVNSQVADMEEIRAAFTSEYQKSVKRKADLTKTLALLQD-----RQKNFANV-D-LDKLELLKSRVEA 631  Ogataea parap...
XP_011271529  648 NELDNRLIDHLDIIEKDSINISNKVKELTNFEEELDLELENLSEQMNDLIE-----QNEIFQAS-Q-NEDVMQTRNNLYK 720  Wickerhamomyc...
Q5B2K9       1204 LEEEIAAKRQVLEELQTQIQDKTDTIETGTELKAEVMAQIQEAERVKEECRGWSAKEIRELKDSVHRIEQRTGWSISSAS 1283 Aspergillus n...
Q6CMN2        572 NMLKVS----DLNQLTTKKDQLTQKIQDAKLEMSKVNEEIAQLRQDLKQSKVCTEYDVAKLKLVHQLYQSISGIKFRKLV 647  Kluyveromyces...
Q754X4        651 NMIKLN----NTANLEEQKEAISADINALRSQIKDVREEISSLKSLVLKNKLHTAHDVSKLRLLFSQMQLFTGVSFRGLS 726  Eremothecium ...
CCE78174      900 CKEKYHYLKEVEMERQLRLEEISIKIQKNKELISTFNKDINEHEKIINDNRKYEKSEIEQLKTKYNMLQSITNLKYNSMK 979  Pichia farino...
XP_003644801  641 NMVKLN----GLEDLEKQRTIIRENKSKLHSQIAAVKKEIDSLKALLNRKKIHSSYDVKKLQNMFSQIQLFTGINFVKLV 716  Eremothecium ...
XP_007377455  784 HKLKMAELGNKIVDRTGELERINVKLADIGNKRTELVSELSQAQQVVQKTKLNDKSEVIARHLTFKFLQQITKLQFVNED 863  Spathaspora p...
XP_001647283  590 HSVKI----GQIKELQNKRNDVLTKISKTKESLSQTKLELENSNRAQRLDSHFSEFELNRLKNRFSMFQTLSGIEFVSLK 665  Vanderwaltozy...
XP_003687472  592 NGIKLE----EYTTLKTKKEGLLLYVKEMNDKITSVRKEISALAADTMKGKVFTTYDISRLKMKFSLLQNITNVKFVSMV 667  Tetrapisispor...
XP_013933112  632 AQEQNARLREAKAKLQKEIAEKEEIFKLVSTQLLEAQEEDKRLKKRVMELKLPSQNELDLLQQQFVDLQRTTQVELLVLN 711  Ogataea parap...
XP_011271529  721 ILKDLNNQEENLEKCQIKNDELSQKV----SQYKEIEEIVEQKEHIVKINGMDLDTRVQIWTKQFVALQSISGIKLLSLN 796  Wickerhamomyc...
Q5B2K9       1284 ssetGLAVTMVYR-HQ--LQLKFYPAS 1307 Aspergillus nidulans
Q6CMN2        648 ----GPVLSVSLH-DDk-VIVTADLSK 668  Kluyveromyces lactis
Q754X4        727 ----GSELQLALN-ST--INVSFDLTQ 746  Eremothecium gossypii
CCE78174      980 ----QNVISFTFY-NT--LNIKMDFSd 999  Pichia farinosa CBS 7064
XP_003644801  717 ----GSELHLSLKaNK--VNIGFDLlk 737  Eremothecium cymbalariae DBVPG#7215
XP_007377455  864 ----NGVWEFIYY-QD--IKCRFDIKN 883  Spathaspora passalidarum NRRL Y-27907
XP_001647283  666 ----KSTLIVKSP-IEefPEIVIDLSK 687  Vanderwaltozyma polyspora DSM 70294
XP_003687472  668 ----NSTLQIKLN-IKmfpvinvemrn 689  Tetrapisispora phaffii CBS 4417
XP_013933112  712 ----EKEFKVQIM-KE--LQISVDLSt 731  Ogataea parapolymorpha DL-1
XP_011271529  797 ----DTILNVSFA-SNm-ITASIDLTK 817  Wickerhamomyces ciferrii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap