4DW8,1NF2,3L7Y,4QJB,2B30


Conserved Protein Domain Family
Hydrolase_3

?
pfam08282: Hydrolase_3 
Click on image for an interactive view with Cn3D
haloacid dehalogenase-like hydrolase
This family contains haloacid dehalogenase-like hydrolase enzymes.
Statistics
?
Aligned: 71 rows
Threshold Bit Score: 156.239
Threshold Setting Gi: 74862782
Created: 21-Mar-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4DW8_A   8 IVLDLDGTLTNSKKEIS-SRNRETLIRIQeQGIRLVLASGRPTYGIVPLANELrmnEFG---GFILSYNGGeIIn---WE 80  Bacteroides thetaiota...
Q9CDS0   6 IFTDMDGTLLDSHGSVS-DTNHWSIYY---SDLPITLVSARSPLEMSNIVEKL---QLR---TPQIAFNGN-LTftqnQF 74  Lactococcus lactis su...
Q8DVI0   8 ILSDIDGTILDNNHQVD-AHLRDTITELKkESIPFVLASARSPHGMFPIAQEL---NLGa--NPIACYNGA-LIvegnKE 80  Streptococcus mutans
Q98LI0   7 IVTDVDRTLLTHDHVLP-QRVADALHVAReAGIMIVLATARSPLGLKPYAEKL---GIA---GLAICFNGG-WIg--nVS 76  Mesorhizobium loti
Q8DQ66   5 LALDMDGTLLNEAKEIP-QAHITAIHKAIeKGVKLVLCTGRPLFGVLPYYKKL---GLDlqnEYVIVNNGC-STh---QT 76  Streptococcus pneumon...
Q880N4  12 LLSDIDGTLLRRDHSLS-QVNIEAIGRLRqAGIHFTLASSRPPRAMRQVIEAL---GVD---LPTVAFNGG-TIt---HP 80  Pseudomonas syringae ...
Q89FD8   7 VVSDVDGTLLTKDKTLT-ERARSAVQRLHqAGIGFTITSSRPAIGMRFLIEPL---ALW---LPVGPFNGS-SIv---DP 75  Bradyrhizobium japonicum
Q9CJC6   8 FATDMDGTFLHNDHSYNhKKLAEVIKKIQdRNLLFAASSGRSLLGLIEVFSEY---KDQ---MAFVAENGG-VV----AY 76  Lactococcus lactis su...
Q9A0X9   5 IATDMDGTFLAEDGTYNqEQLAALLPKLAeKGILFAVSSGRSLLAIDQLFEPF---LDQ---IAVIAENGS-VV----QY 73  Streptococcus pyogene...
Q8Y9V0   5 ISVDMDGTFLDGNGEYDrARFEKIYAELMkRGIKFIVASGNQYYQLKSFFPGK---DEE---LFYVAENGA-VI----FH 73  Listeria monocytogenes
4DW8_A  81 SKEMM-YENVLPNEVVPVLYECARTNH----LSILTYDGAEIVTENS-LDPYVQKEAFLNKMAIRETNDFLTDITLPVAK 154 Bacteroides thetaiota...
Q9CDS0  75 GLQII-DKNPLASETVSQLLNYISTEFp--nVSLNWYSLAHWYINKQ-----DKGTFIQKAITGIEPKIKTFDGQSEIYK 146 Lactococcus lactis su...
Q8DVI0  81 HYQTL-IEHGLSKADVKKIVALIKKQFp--hISINFYSGGDWIVEEIdQWVQIEADITKESPDIRNFDTLLTDDAIPIHK 157 Streptococcus mutans
Q98LI0  77 TGVAL-SEQRIGRTDALHTMATAQAAG----VRPMWFTGHAIHALAE---DPIIAREASVTAEPLVVAKALEDLPGEPGK 148 Mesorhizobium loti
Q8DQ66  77 SDWGLvDWQELSPADIEYLYDLAEKSD----VQLTLFDESHYFVLGG----KPNQVIENDAKLVFSDLTEISLEEATSGK 148 Streptococcus pneumon...
Q880N4  81 DGSLL-AAHRIDPAAVRTCLELFAGHN----VAIWVFADDQWLLLDP--GADYVDHERDALGYDYVQVESFESYLDRVDK 153 Pseudomonas syringae ...
Q89FD8  76 EMKPV-EQHLIPAGAVERSLQILREFR----ADIWLFTTDKWLIDNP--GGKYVAHEQHTIRSDPTIVTDFSPYLASACK 148 Bradyrhizobium japonicum
Q9CJC6  77 KGEIL-FAKDLTVAQTQELIDDLQEMPfspkNDYLISGLKGAYYPEG-ISKEYLTHAKLYYPNCQLYHRLDEIDD-KLLK 153 Lactococcus lactis su...
Q9A0X9  74 RGEIL-FADMMTKEQYTEVAKKILANPhyveTGMVFSGQKAAYILKG-ASEEYIQKTKHYYANVKVINGFEDMENDAIFK 151 Streptococcus pyogene...
Q8Y9V0  74 QGELR-SVNRFDERLVQKILWTLIQDYh--dLQVILCGVKSAYLLKA-ADPDFKAFAKKYYFELQEVESFDVLPDDTFIK 149 Listeria monocytogenes
4DW8_A 155 CL-----IVGDAGKLIPVESELCIRLQGKINVFRSEPYFLELVPQGIDKALSLSVLLENIGMTREEVIAIGDGYNDLSMI 229 Bacteroides thetaiota...
Q9CDS0 147 IMm----IVFDSQELLQLQAQLNNLNIPNISVQQSGQWYLEITSDNKTKADAVQSILDNKNLDFQEIAAIGDGHNDIPLL 222 Lactococcus lactis su...
Q8DVI0 158 LL-----LIANAQAIQEFFTYLKRVNFEDASFYLSKDNYLEVTSQSVSKENALLEIAKYYDISLSQTMAIGDNYNDIPML 232 Streptococcus mutans
Q98LI0 149 IM-----CVAAQPMDREAFGALRVQLARCLSVSGSHPRLLEIGPLGISKKTAIATVATELGMAASDCAAAGDAENDLEML 223 Mesorhizobium loti
Q8DQ66 149 FRmfqgmFLGTKEQTDDFEQRFAEELCQRFSGVRSQPVIYEAMPLGTTKATALSRLAEILKIDSSEIMAMGDANNDIEML 228 Streptococcus pneumon...
Q880N4 154 IVa----ASADFELLKTLESQLNPQIEGLALAARSQKYYLDVTALDANKGSALVALAKYLGVELSRTAAIGDGGNDVAMF 229 Pseudomonas syringae ...
Q89FD8 149 IVg----ASTDAAGLERCEKAMQEALGSEATAVRSQTYYLDITPPGFNKGTFVEAMAKRLGIATDTVATIGDMQNDLAMF 224 Bradyrhizobium japonicum
Q9CJC6 154 VT-----TNFPEDHVRDCEQWITDRLSFV-RATTTGFTSIDIVPNGISKASGLVHLLAHFNWLPENLAVFGDQMNDLEMF 227 Lactococcus lactis su...
Q9A0X9 152 VS-----TNFTGHTVLEGSDWLNQALPYA-TAVTTGFDSIDIILKEVNKGFGMEHLCQALGIKKAETIAFGDNFNDYQML 225 Streptococcus pyogene...
Q8Y9V0 150 FA-----LDVEVAKTGQIVEDLNQTFVGEIRAVSSGHGSIDIIIPGVTKGNAIQQLLNEWQVAPEDLLAFGDANNDIEML 224 Listeria monocytogenes
4DW8_A 230 KFAGMGVAMGNAQEPVKKAADYITLTNDEDGVAEAI 265 Bacteroides thetaiotaomicron VPI-5482
Q9CDS0 223 QSAGLAIAVDNANSEVKKHVKMVVAKNTEHGVAEAI 258 Lactococcus lactis subsp. lactis
Q8DVI0 233 KLAGLGVAMANAPQAVKNEADIETVSNNDNGVSKVI 268 Streptococcus mutans
Q98LI0 224 VWAGTAVSVENAVPEAKRLAHFVGPSCDEGGLADAV 259 Mesorhizobium loti
Q8DQ66 229 QFAGLGIAMGNASDYVKSLADAVTSSNEEDGVARAI 264 Streptococcus pneumoniae R6
Q880N4 230 HAAGLSIAMGQGEQTVKGQADHVTDSNEQDGVAKAI 265 Pseudomonas syringae pv. tomato
Q89FD8 225 RVSGTSIAMGNATDDVKDRATHVTATNEQDGFAEAM 260 Bradyrhizobium japonicum
Q9CJC6 228 EYAGSSFAVSNAAPEILELADKVILSNDEDAVLVEI 263 Lactococcus lactis subsp. lactis
Q9A0X9 226 EFAGRAIATENARPEIKVISDQVIGHCNDGAVLTYL 261 Streptococcus pyogenes serotype M1
Q8Y9V0 225 QLTSNSYAMLESSPEVLAAAKHVAPSNKEAGVLQVI 260 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap