3MHH


Conserved Protein Domain Family
Sgf11

?
pfam08209: Sgf11 
Click on image for an interactive view with Cn3D
Sgf11 (transcriptional regulation protein)
The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae. The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation.
Statistics
?
PSSM-Id: 285427
View PSSM: pfam08209
Aligned: 33 rows
Threshold Bit Score: 46.8061
Threshold Setting Gi: 168003565
Created: 20-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30
                  ....*....|....*....|....*....|...
3MHH_C         67 SSQYIHCENCGRDVSANRLAAHLQRCLSRGARR 99
gi 1160421906  89 TSRYFRCLNCGRNIAGGRFASHISKCLE---RK 118
gi 229890179   71 ASRYFSCENCGRKIAGGRYAQHVNKCLE---RR 100
gi 74603465    69 TSKYFQCENCGRSIAGGRFAQHMTKCLE---RR 98
gi 74635937   100 DSQYFECPKCMRKVAGARFCAHIERCLSGGGRS 132
gi 290984492   90 TRTHVVCANCKREIGHSGYAPHLERCLNMrgsr 122
gi 168003565  893 TKARVPCSDCGRSMTPGRIERHLQRCSL---KR 922
gi 1020697684 210 YIPWHTCPNCKRSLLITRFAQHLEKCLGISGRQ 242
gi 679996781  194 DYPTIKCPNCPRYCQTNRVAAHLDRCMGISGRT 226
gi 1050827782  91 DTEYFTCLNCDRKIAGNRFASHVDRCLG--GRT 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap