1YBY,5J3B,3OYY,1UEB,5WXK


Conserved Protein Domain Family
EFP_N

?
pfam08207: EFP_N 
Click on image for an interactive view with Cn3D
Elongation factor P (EF-P) KOW-like domain
Statistics
?
PSSM-Id: 369752
View PSSM: pfam08207
Aligned: 182 rows
Threshold Bit Score: 48.9517
Threshold Setting Gi: 81658859
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YBY_A         33 SAGDFKNGVTFELDGQIFQVIEFQHVKPGKGAAFVRTKLKNIVTGATIEKTFNPTDK 89  Hungateiclostridium thermocellum
A5UYR6          3 TTSDLRTNMIIRYNGQLHRVVEFYHHAPGNWRAMVIMKLKNLETGKTIEERVRAGSe 59  Roseiflexus sp. RS-1
A9WFA4          5 TTSDLRNGIVIRYNNDLYQVVEFQHVAPGNWRAFVRMKLKSLTTGKVIEDRVRAGAe 61  Chloroflexus aurantiacus J-10-fl
Q1IKJ3          4 PATQMRPGMVIKHNNDLHSVFSVEHRTPGNLRAFIQAKLRNLRTGAMFEHRFRSGDP 60  Candidatus Koribacter versatilis Elli...
Q8KG11          3 SISNVSRGAIIRWNGAPHSIESLVHRTPGNLRAFYQASMKNLKTGRNVEYRFSATEQ 59  Chlorobaculum tepidum TLS
jgi:Phep_4276   3 KASDIKNGNILRFNGELVQVEEFLHRTPGNLRAFYQARMRNVKTGKLVEYRFRVDEE 59  Pedobacter heparinus DSM 2366
Q73P31          3 RGGDIAKGTVLLNKGTPYLVVEREFVNPGKGAAFARVKMKNLRDGSVLMQTIKTADT 59  Treponema denticola ATCC 35405
O51232          5 kSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADt 61  Borreliella burgdorferi B31
Q6MD56          3 TSNQLTPGMTLSINNKLYRVESSVKVTVPKGTPFIKAKLKDLSNNEMVEKSFKlnqp 59  Candidatus Protochlamydia amoebophila...
Q8EXB9          4 giTEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTRNSSIERTFKAAEK 60  Leptospira interrogans serovar Lai st...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap