1YBY,5J3B,3OYY,1UEB


Conserved Protein Domain Family
EFP_N

?
pfam08207: EFP_N 
Click on image for an interactive view with Cn3D
Elongation factor P (EF-P) KOW-like domain
Statistics
?
PSSM-Id: 336954
View PSSM: pfam08207
Aligned: 181 rows
Threshold Bit Score: 48.9517
Threshold Setting Gi: 81658859
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YBY_A        33 SAGDFKNGVTFELDGQIFQVIEFQHVKPGKGAAFVRTKLKNIVTGATIEKTFNPTDK 89  Clostridium thermocellum
A5UYR6         3 TTSDLRTNMIIRYNGQLHRVVEFYHHAPGNWRAMVIMKLKNLETGKTIEERVRAGSe 59  Roseiflexus sp. RS-1
A9WFA4         5 TTSDLRNGIVIRYNNDLYQVVEFQHVAPGNWRAFVRMKLKSLTTGKVIEDRVRAGAe 61  Chloroflexus aurantiacus J-10-fl
Q1IKJ3         4 PATQMRPGMVIKHNNDLHSVFSVEHRTPGNLRAFIQAKLRNLRTGAMFEHRFRSGDP 60  Candidatus Koribacter versatilis Ellin345
Q8KG11         3 SISNVSRGAIIRWNGAPHSIESLVHRTPGNLRAFYQASMKNLKTGRNVEYRFSATEQ 59  Chlorobium tepidum TLS
Q73P31         3 RGGDIAKGTVLLNKGTPYLVVEREFVNPGKGAAFARVKMKNLRDGSVLMQTIKTADT 59  Treponema denticola ATCC 35405
O51232         5 kSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADt 61  Borrelia burgdorferi B31
Q6MD56         3 TSNQLTPGMTLSINNKLYRVESSVKVTVPKGTPFIKAKLKDLSNNEMVEKSFKlnqp 59  Candidatus Protochlamydia amoebophila ...
Q8EXB9         4 giTEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTRNSSIERTFKAAEK 60  Leptospira interrogans serovar Lai str...
WP_055133862   3 KASDIKNGNILRFNGELVQVEEFLHRTPGNLRAFYQARMRNVKTGKLVEYRFRVDEE 59  Pedobacter sp. Hv1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap