Conserved Protein Domain Family
Pedibin

?
pfam08182: Pedibin 
Pedibin/Hym-346 family
This family consists of the pedibin and Hym-346 signalling peptides. These two peptides have been isolated from Hydra vulgaris and Hydra magnipapillata. Experiments have indicated that both cause a reduction in the positional value gradient, the principle patterning process governing the maintenance of form in the adult hydra. The peptides cause an increase in the rate of foot regeneration following bisection of the body column. Thus both play important signalling roles in patterning processes in cnidaria and maybe in more complex metazoans.
Statistics
?
Aligned: 3 rows
Threshold Bit Score: 39.4991
Threshold Setting Gi: 313230146
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A0CIE5   270 NLQREISLLQILLADGDDVQNQLEQKEKELQNIET 304 Paramecium tetraurelia
CBY07850 539 KLRAEIDVLNSVKAEGEDRCKELENKCKALSVFKK 573 Oikopleura dioica
A0E2R1   270 QLCKEIRQLQIQYFDGEEVDELLEQKENELKNVEL 304 Paramecium tetraurelia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap