Conserved Protein Domain Family
NUC129

?
pfam08157: NUC129 
NUC129 domain
This C terminal domain is found in a novel family of hypothetical nucleolar proteins.
Statistics
?
PSSM-Id: 311882
View PSSM: pfam08157
Aligned: 15 rows
Threshold Bit Score: 104.755
Threshold Setting Gi: 82267072
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4SNJ0       139 YTVTTVQQCSSACSQQQAAEEFLRSRLYGPGSCRSTCNQLLSLHNKRSRVKGAAVQFVKKDWA 201 spotted green pufferfish
XP_005995265 158 YMAVRLKDQGQINLQQERAQDFIQDCLYGPGSNRTTANELFSLSNKKCFNKKAAVQFVDKSWG 220 coelacanth
XP_007668792 128 YTAVRLRDHTLANIQMQEAKAFIQKQLYGPGNSRTTVNQFFSLAQKKLPDKKAAIHFVNETWG 190 platypus
CAF97792     139 YTVTTVQQCSSACSQQQAAEEFLRSRLYGPGSCRSTCNQLLSLHNKRSRVKGAAVQFVKKDWA 201 spotted green pufferfish
XP_006634436 156 YKVQRVKDHSLAKAQQTSACDFITSRLYGSGSNRTTTNQLLSLQNKTAKNKRAAVQFIDKQWd 218 spotted gar
XP_014330320 146 YTVSTVTDRGQSDYQRQAAEDFIQSRLYGPGSCRSSNNEMLSLQNKTRADKSAAVQFVKKDWA 208 southern platyfish
XP_003760216 151 YVACRLKDQDLIDLRQQAAKGFIQKYLYGRGSNRTTVNKFLSLDNKRLPVKKPAVQFVNNNWG 213 Tasmanian devil
XP_008107017 162 YKAVRLKDESLTNKQQQVAKKFIQRHLYGEGSNRTTANQYFSVENKKSKVKKAAIQFVNNSWG 224 green anole
EOA98251       6 YTAMHLKDQSLTGLHQQTAKDFVYSHLYGPGTNRTSANEFFSLANKKDPVKKAAVQFVDKSWG 68  mallard
XP_005041637  83 YMAVCLKDHSVTGLHQQLAKDFLNAQLYGPHTNRVQANEFFSLANKKAPVKKAAVQFVDKSWG 145 collared flycatcher
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap