3J65


Conserved Protein Domain Family
NOGCT

?
pfam08155: NOGCT 
NOGCT (NUC087) domain
This C terminal domain is found in the NOG subfamily of nucleolar GTP-binding proteins.
Statistics
?
PSSM-Id: 400463
View PSSM: pfam08155
Aligned: 85 rows
Threshold Bit Score: 79.0765
Threshold Setting Gi: 260799447
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3J65_OO      399 ARDIEAENGGAGVFNVNLKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEI 449
EFC41700     400 EKHLENEGGGSGVYMPDYKKHYLLKNEEWKYDIIPEFINGKNIADFVDPEI 450 Naegleria gruberi
EPE05537     404 EKELEEMYGGPGVYNFDMKRDYVGIDPEHQHDTMPEIKNGLNVHDFYHPSI 454 Ophiostoma piceae UAMH 11346
EDO07998     382 EKSLEDAGGGPGVYSVDQRKHHILADDSWRYDEVPEIYRGRNVVDYAYPGn 432 Babesia bovis
Q4N5P2       384 EKDLEEKFGGAGVYSVDLRKNHILANEEWKYDEVPEIYNGRNVVDFAFPGI 434 Theileria parva
OAV89377     399 EKDLEAQNGGPGVYSVDLKKSYLLANEDWKQDNIPEIINGKNVADFVDPDI 449 Puccinia triticina 1-1 BBBD Race 1
XP_006854730 413 EKDLENENGGAGVYSASLKKNYILPNDEWKEDLMPEIFEGHNVTDFVDPDI 463 Amborella trichopoda
EFJ25861     392 EKDLENENGGAGVYSANLRRRYILADESWKEDVVPEIADGHNIADFIDTDI 442 Selaginella moellendorffii
VDC65369     401 EKDLEDENGGAGVYNVSLKKKYILADESWKDDIIPEICDGHNVADFMDPDI 451 field mustard
XP_009417039 412 EKDLEEENGGAGVYSANLRKHYILADEEWKEDIMPEILDGHNVYDFVDPDI 462 wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap