1N7Q,1HM3


Conserved Protein Domain Family
Lyase_8_N

?
pfam08124: Lyase_8_N 
Click on image for an interactive view with Cn3D
Polysaccharide lyase family 8, N terminal alpha-helical domain
This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
Statistics
?
PSSM-Id: 311858
View PSSM: pfam08124
Aligned: 15 rows
Threshold Bit Score: 336.626
Threshold Setting Gi: 14278192
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1N7Q_A         12 WNGII------AGNQyYDSKNDQMAKLNQELEGKVADSLSSISS--QADRIYLWEKFS--------NYKTSANL--TATY 73   Streptococcus...
Q7MP30         51 WASYF------LGDQ-TMAFDQQLTNEITKINHQAKQWLDQL----TIDENGLWADLPlqtdnaeqKRKLGIQL--YATY 117  Vibrio vulnif...
Q7MP31         73 WM-------------------QQFQSSRTNVN------------------AGLWLDLPlatateqdKKQLGDQL--YKSY 113  Vibrio vulnif...
Q82JQ0         45 WLVLA------LGAG-YDPTAEPYASRLRRTGELARGYRATM----APAAASLWPGHP---------FDPPSGI--TQSY 102  Streptomyces ...
P0CZ01         46 WIDII------TGRRaARTSDPRARAIIAKTDRKVAEILTDLVSgsSRQTVLISADLR---------KEQSPFI--TKTA 108  Propionibacte...
Q8A3J0         19 WDLVLpcpsicTSALqNDDFDILMKKIRDGVAENPN----------IDKALELYDDVQgcfididyARRDRTNWmpLIHV 88   Bacteroides t...
Q837L8        241 WRNQL------VSKE-YDSTNQALVDYVQKISNEATELDQTMNK--EPNRSYLWPLEP--------GNTPSADL--TTQF 301  Enterococcus ...
Q034G7         85 WRDRL------IATK-PDMSDPNVKAYLTDLAAQSQTLWATMDR--SANRSRLWLKKS--------SDTTSADY--TSMF 145  Lactobacillus...
Q82ZM8        271 WKMRL------LGTTqYD-NDADVQQYRAQIATESLALWQTLNQ--AADREYLWERKP--------SDTVSADY--TTQF 331  Enterococcus ...
WP_011691558   50 WVDQI------TGRKvLVAGDNDFVTALAALDKKARTAIDLLER--SAGRLTVFSDLS---------LAKDTDL--VTTH 110  Arthrobacter ...
1N7Q_A         74 RKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVYNSEKSIVGNAADYEIGTPRAINNTLSLMKEYFS---DEEIK 150  Streptococcus...
Q7MP30        118 QRIFTLARAYKLPGGELENDPQLLAMLVESLAFLHDNFYHVGTAEWGNWWHWQLGIGRVANNTLVVLYDELP---QEIIS 194  Vibrio vulnif...
Q7MP31        114 QRLFTMAQAYQLPKSDLYQSVELLDVITEGLAILNQHFYKVGVEEWGNWWHWQLGISRVANNILVLMYQELP---ASLVT 190  Vibrio vulnif...
Q82JQ0        103 SRLWTMTQAYVQEGTGSTGDAGLLADIVRGLDHVSATVYNPTTTRYGNWWEWQIGSPRLLMDIVAALHDRLS---AARRA 179  Streptomyces ...
P0CZ01        109 RAIESMACAWATPGSSYHKDPEILSACIEGLRDFCRLRYNPSQDEYGNWWDWEDGASRAVADVMCILHDVLP---PEVMS 185  Propionibacte...
Q8A3J0         89 DRLYDFVFAYTHPKNSYYQNEDLYHKIVKGLEYWHHRNPHCN-----NWWYNQIAEPQKLGILLIQMRVGKRqipEVLET 163  Bacteroides t...
Q837L8        302 TKLQKLALAYGTKGSTLYQDDKLAATIIDGLDFMVTQKGYDGKKYHGNWWDWQIGVPQKFLNILMILEDKVS---PEKQQ 378  Enterococcus ...
Q034G7        146 TNIKMLTLGYYNPVSQQHQNPEVYQAIIDAIDFMETAKKYNGSYSTGNWWDWQIGSAQQLDDTLILLYNDLHrqdPEKLV 225  Lactobacillus...
Q82ZM8        332 TNIKKLALGYYEPSSELFEKPEVYDAIVKGIEFMIDTKKYNGTYYTGNWWDWQIGSAQPLTDTLILLHDDLLntdAEKLN 411  Enterococcus ...
WP_011691558  111 TRLATMATAWATPGSEHFADAGLLAAIRAGLADANSLCYNASKEEQGNWWSWEIGTPKALADTMVLLHAELT---AAERA 187  Arthrobacter ...
1N7Q_A        151 KYTDVIEKFVPDP--------EHFRKTTDN--PFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEG 220  Streptococcus...
Q7MP30        195 NYVDASRYFVPRPthl--segYGAPYSSAPl-MFESTGGNRTDNAQVVLIRGILDNNENEIKSAVESLSSIIPFVTEGDG 271  Vibrio vulnif...
Q7MP31        191 NYIDAIEYFVPNPthl--segAGASASSMPr-PFESTGANRVQNVQVVLVRALLANDQDAFQTAVDALEPVITFVESGDG 267  Vibrio vulnif...
Q82JQ0        180 AACAAVGHFIPDD-------------MLRDy-SGTSTGANRVDLCRGVALSGILGRAPDRIALARDALSPVFPYVTQGDG 245  Streptomyces ...
P0CZ01        186 AAAAGIDHFIPDPwfq---qpASVKPTANPvqPVVSTGANRMDLTRAVMCRSIATGDEKRLRHAVDGLPDAWRVTTEGDG 262  Propionibacte...
Q8A3J0        164 KVLQRMRKDGGHP--------------------ARWTGANRTDIALHWIYRACLQKNDVDLKTAVENVYSPLSYTVK-EG 222  Bacteroides t...
Q837L8        379 IYTNALSSYVPDPfkqlytkpQGTFVDLAFipNFVTSGANRTDLALTVLGLGILQKDSGKINQASSSIVDVFKLVTKGDG 458  Enterococcus ...
Q034G7        226 KFVQPLLGYAKDP-------------NIQWp-AYTATGANLTDISISVLASGLLLEDDKRVALVQQNLPKAMGLVTAKDG 291  Lactobacillus...
Q82ZM8        412 KFTAPLMLYAKDP-------------NIQWp-IYRATGANLTDISITVLGTGLLLEDNQRLVQVQEAVPSVLKSVSSGDG 477  Enterococcus ...
WP_011691558  188 AYCAAIDHFVPDP---------WQQFPPKRg-KITSVGANRVDLCQAVTIRSLVDEDAEKLTHAVAGLSEVWQYVSAGNG 257  Arthrobacter ...
1N7Q_A        221 FYQDGSYIDHTNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFAPLLVNGELMDMSRGRSISRANS 300  Streptococcus...
Q7MP30        272 FYQDGSFIQHKDLPYSGTYGQVMVEGLGMLMGLVANTPWQANDPNLQKIYPLLLEAFAPLLVDGKMMDMVNGRAISRISG 351  Vibrio vulnif...
Q7MP31        268 FYSDGSFIQHTDIPYNGSYGNELLEGLGLLLGTIASAPWNEQTEQYSAIYSLLLEAYAPFLVDGRMMDMVNGRAVSRLSG 347  Vibrio vulnif...
Q82JQ0        246 LYADGSFVQHTWVAYSGTYGQVLLDGLGRLFSLFAGSTWDVTDPNRQIILDSVEQAYAPLIHDGLVMDSVNGRAISRGYL 325  Streptomyces ...
P0CZ01        263 FRADGGFIQHSHIPYTGGYGDVLFSGLAMLFPLVSGMRFDIVESARKAFHDQVERGFIPVMYNGQILDDVRGRSISRINE 342  Propionibacte...
Q8A3J0        223 FQHDNSYFQHGVQLYIGGYGDEILKGVTQVALYTKGTKYALDDERIQFLRHFMCGTYYQVIRGQYMLFDVLGRGVSRNNA 302  Bacteroides t...
Q837L8        459 FYQDGSFIQHNNIPYTGSYGNVLVKGVGQILAITADSSFQMDATLVTEFVENVDRAFLPLIYKGEMLPTVNGRSISRAPA 538  Enterococcus ...
Q034G7        292 IYADGSFVQHTFFPYNGSYGNEMIKGIARVSSTLVGTPWAISEVQFANVFNLIDKGFLQLMVNGRMPSMLSGRSISRAPG 371  Lactobacillus...
Q82ZM8        478 LYPDGSLIQHGYFPYNGSYGNELLKGFGRIQTILQGSDWEMNDPNISNLFNVVDKGYLQLMVNGKMPSMVSGRSISRAPE 557  Enterococcus ...
WP_011691558  258 FFTDGSFIQHSTTPYTGSYGVVLLTGLSKLFALLGGTGAEVSDPSRDILFKTVEGSFAPFMVAGAMADSVRGRSISRESN 337  Arthrobacter ...
1N7Q_A        301 E---------GH-VAAVEVLRGIHRIADMSEGETKQRLQSLVKT 334  Streptococcus pneumoniae
Q7MP30        352 Q---------NQ-KVGQAMLSSMLLYLPGAPENYKQQLGEFLKS 385  Vibrio vulnificus YJ016
Q7MP31        348 Q---------NH-KIGHAVLNSMLFFIESAPSNVKKQLQSVIKT 381  Vibrio vulnificus YJ016
Q82JQ0        326 KsddlhvmrgDH-FHGQALIAAIALLAGGAGPQERARWHARIKG 368  Streptomyces avermitilis
P0CZ01        343 S---------AA-MHGISIARAMLMMADALPTHRAEQWRGIVHG 376  Propionibacterium acnes KPA171202
Q8A3J0        303 T---------QK-SHAALFAKRMLEL---APAHID-EYNAIIAR 332  Bacteroides thetaiotaomicron
Q837L8        539 V---------GKtGYGSTTMYNLLIVAKFAPNNYQKKFQEAVKY 573  Enterococcus faecalis
Q034G7        372 T------------ECGNHGV------GDWQRDVSQSDLDCRGNA 397  Lactobacillus paracasei ATCC 334
Q82ZM8        558 Tnpf----ttEF-ESGKETIANLTLIAKFAPENLRNDIYTSIQT 596  Enterococcus faecalis
WP_011691558  338 T---------GF-DLGASTIESILLLARAVDPVTARRWRSLCLA 371  Arthrobacter sp. FB24
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap