Conserved Protein Domain Family
CHDNT

?
pfam08073: CHDNT 
CHDNT (NUC034) domain
The CHDNT domain is found in PHD/RING finger and chromo domain-associated helicases.
Statistics
?
Aligned: 24 rows
Threshold Bit Score: 72.6826
Threshold Setting Gi: 0
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDV97502      132 EIEYSEEDLQSLTTYKAFMQHVRPILQKENPKIAATKLMMLVAAKWREFCESNP 185  Drosophila grimshawi
XP_018648915   80 EMTYSTEDFENWTIQKLFDQYVRPLIANKNPNASKEDVQKVLDAKWKEFAIMNP 133  Schistosoma mansoni
2_pfamImport    1 DHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNP 54  
EFV57776      114 vLNYLDDDFQGITNYKAFNTKVRPMILESNPKIAKARLVTLMATKWKEFQEvcs 167  Trichinella spiralis
4_pfamImport    1 -ANLEDEDYTTITTLKAFTNRVRPTLQTANPKANSTKLLPIIQAKYREFQEE-- 51  
EGT46684       80 vLDYDGHLFHGISGIKSFQALIRPVVLHHNPGAVHAKILRLIQEKFEEFQNHMa 133  Caenorhabditis brenneri
6_pfamImport    1 EVDYDQAELQGVSSIKAFTAVIRQQLLEANPGTNLSKMYPLQQVKYREFQEHMT 54  
G5EBZ4         95 EFDYDEEEFQGISNLKTFSSIIKPQILEANPGTNVSKMYPMFQVKYKEYQDHMa 148  Caenorhabditis elegans
Q22516         97 DVDYEQEEFQSITNLKNFSSLVKPYILKVNPGTNVTKMYPLFQVKYKEFQDHMT 150  Caenorhabditis elegans
9_pfamImport    1 EMEYTESDYDELINYKLYTDNIRPLVLENAPKLHSQKLVNLLAALWKEFAANNP 54  
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap