2APO


Conserved Protein Domain Family
DKCLD

?
pfam08068: DKCLD 
Click on image for an interactive view with Cn3D
DKCLD (NUC011) domain
This is a TruB_N/PUA domain associated N-terminal domain of Dyskerin-like proteins.
Statistics
?
PSSM-Id: 336916
View PSSM: pfam08068
Aligned: 52 rows
Threshold Bit Score: 81.021
Threshold Setting Gi: 504398918
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2APO_A        35 DKEELIVKEE-VETNWDYGCNPYERKIEDLIKYGVVVVDKPRGPTSHEV 82  Methanocaldococcus jannaschii
Q8TZ08        13 RDREMITKAE-VETDPRYGCPPEERPIEEYIMKGVINLDKPAGPTSHEV 60  Methanopyrus kandleri AV19
P60346        27 EKYEIWVKKE-AETNEKWGEDPYNRPIERLLKYSVINLDKPSGPTSHQV 74  Nanoarchaeum equitans Kin4-M
Q57612        14 DKEELIVKEE-VETNWDYGCNPYERKIEDLIKYGVVVVDKPRGPTSHEV 61  Methanocaldococcus jannaschii DSM 2661
EJW02475      16 DIDKMHVKTL-HHTPLKTGFEPLKRPLLEHLKYGVVFIDKVKGPSSHEI 63  Edhazardia aedis USNM 41457
XP_007605036  10 NQDQMVVKSR-DHNPSGHGTMPVNRPIGEYLKYGVVTVDKPANPSSHEV 57  Vittaforma corneae ATCC 50505
EPR79875      11 NLENMAIKTE-SFNVQSRGNIPELRPIDEYLKYGVITLDKPQNPSSHEV 58  Spraguea lophii 42_110
WP_004068761  15 IKREIVIKDEkAETNPKWGFPPDKRPIEMHMQFGVINLDKPPGPTSHEV 63  Thermococcus litoralis
WP_013037780  16 RQREYILKGD-AHTDPSYGCPPHKRPLSFYMRMGVVNLDKPAGPTSHEV 63  Methanohalophilus mahii
EHY65272      46 GLEDMNIKSL-KYTPTSYGYSPLERPLNIYLEYGVINLDKPCNPSSHEI 93  Nematocida sp. 1 ERTm2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap