Conserved Protein Domain Family
UME

?
pfam08064: UME 
UME (NUC010) domain
This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1.
Statistics
?
PSSM-Id: 336914
View PSSM: pfam08064
Aligned: 131 rows
Threshold Bit Score: 52.5017
Threshold Setting Gi: 953473835
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q59LR2        850 LIEDQVLLLVQKFSDVThSSRGAKPYLELKNSFYAIEFLIKGHIDAITSALGQLS-----------------TCLQATLE 912  Candida albic...
EGO02217      477 FLKDHMLGIISDMNDTLqDVLGKKSISEKRQILRSIGALIGHIGPAINSVSPQIM-----------------AMLQTMFL 539  Serpula lacry...
EMD40504      473 FLRSYMLGVITHINDMLqDVQGKRPIEAKKRIIKSLGPFMTEVGPGVSHVAPQIM-----------------ATLQTMLP 535  Ceriporiopsis...
EEB98563      132 FLKSYILGLITTINDMLqDVHGKKSIETKRMIIRSLGVLVEEVGPGISSVAPQIM-----------------ATFQTMAC 194  Moniliophthor...
XP_006456710  466 FLKVHMLGLMSYINEMLqDMQGKKSVASKRKIIKGLGELIVQIGPNISYGAPQVM-----------------ATFQTMVN 528  Agaricus bisp...
ELU38352      876 FLTNHLLGIVMHINDALqDVRGKATVSQKIQMIKSLGVVVKSVGASSSLVSPQIM-----------------ATLQSMIR 938  Rhizoctonia s...
EPS98761      481 FLSPHVLGIIAGINDQLq--FSKRTVESKRAIIRSIGGFAREMGSLISLAAPQIM-----------------TTLQTMLV 541  Fomitopsis pi...
XP_003036591  430 wLKNKMLGVISCVGNMLqDKSGKKTAEQKRMILRGLGAFISRVGPAIRHIAPQIM-----------------ACYQSVIS 492  Schizophyllum...
XP_001837572  818 FLATQMLGIMSKIIDTLqDVHGKKSVEAKEQIIRSIGVFISLVGPPIHSLSSQIM-----------------AIFQTSLS 880  Coprinopsis c...
CCA73957      601 FLQQHIMAIVTHLNNELqDVHGKRSVDTKQWVLYGLRRVMMLIGESIAVVAPQVSfssyrsyqganisqklvAIMQNTIR 680  Piriformospor...
Q59LR2        913 EPNFHVLSLRCWNELIKKVPPSHLISLIDIIISIILQKF 951  Candida albicans SC5314
EGO02217      540 IPELSEVTLATWFTFLSTLEPNEVGPHVGPTSASFISSW 578  Serpula lacrymans var. lacrymans S7.3
EMD40504      536 IQELVDATLESWFTFLTTLERRDIGPHVGPTSAAFVAFW 574  Ceriporiopsis subvermispora B
EEB98563      195 IPDLADATLTSWHCFLVTMSPEEVGPHIGPASAVFMAFW 233  Moniliophthora perniciosa FA553
XP_006456710  529 VPELSEVTLQSWHKFLTTLEPGEVGPHVGPTSAAIVTAW 567  Agaricus bisporus var. bisporus H97
ELU38352      939 IPELSEATLSTWHSFIETLLIVDAVSLLGVTTATVVRHW 977  Rhizoctonia solani AG-1 IA
EPS98761      542 NPDFTDVTLRSWREFLATLDVQDLGPYVGPTSAFFVMKW 580  Fomitopsis pinicola FP-58527 SS1
XP_003036591  493 APELTEATLESWLIFLQTLEWADIGEVVGTTSSTFVLNW 531  Schizophyllum commune H4-8
XP_001837572  881 VAELAEVTLESWHEYLVTIDSKDLGPHLGSTCSAFVSAW 919  Coprinopsis cinerea okayama7#130
CCA73957      681 IAGLTSVTVEVWQEFASIMSISDFGPYVPLTSAIFVASW 719  Piriformospora indica DSM 11827
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap