2OZB,3NVK


Conserved Protein Domain Family
NOSIC

?
pfam08060: NOSIC (this model, PSSM-Id:254604 is obsolete)
Click on image for an interactive view with Cn3D
NOSIC (NUC001) domain
This is the central domain in Nop56/SIK1-like proteins.
Statistics
?
PSSM-Id: 254604
View PSSM: pfam08060
Aligned: 103 rows
Threshold Bit Score: 51.3572
Threshold Setting Gi: 121717086
Created: 29-Mar-2013
Updated: 4-Apr-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
2OZB_B        20 IVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN 71
gi 75272916  145 IIYSIKLYEEIEKEIFHYYNIQKEWYSWHFPELSKIVTDPEMYSLLIKRIEK 196
gi 75031812   82 VSDCSSLVLRIEVEKSRVHVFLRAQYSIRFPELAMFFSDSVLYAKVVKIIQN 133
gi 74829539   94 VIDSSNLVLRIEVEKSKAVVYARAHYSQRFPELAMFFTSGLLYARVVQLLQN 145
gi 122019591  93 VIDSSTLVLRIEVDKSKAVVYLRAHYGQRFPELAMFFSDSVLYARIVRLIQN 144
gi 74603136  128 ILMVNELSQVINQEISLVHSFIKLQFKVVFSELETLVLNPVDYANIILLIKQ 179
gi 74606296   89 VIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQQ 140
gi 150865843 128 ILLVNELSGIINQEIIAYHQLLKTQYKVVFPELETLVLNPIDYARIIAIIKQ 179
gi 190347705 132 VLAVNDLATIINDEIRFLHSFVKHHYKLVFPELDSLVASAIDYAKSVLVLKQ 183
gi 149245088 147 IVTINELTELINNEIFAFVILLKMQYKLVFPELESIIINNIDYVQIVMMIKQ 198
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap