4QNX,4P7C


Conserved Protein Domain Family
Methyltransf_9

?
pfam08003: Methyltransf_9 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1698)
This family contains many hypothetical proteins. It also includes two putative methyltransferase proteins.
Statistics
?
PSSM-Id: 285275
View PSSM: pfam08003
Aligned: 11 rows
Threshold Bit Score: 536.977
Threshold Setting Gi: 609412606
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4QNX_B   7 FYSLIAK-NHLSHWLETLPAQIANWQrEQQHGLFKQWSNAVEFLPEIKPYRLDLLHS-VTAESEEPLSAGQIKR-IETLM 83  Escherichia coli K-12
Q7MJ71   7 FYQLIAQdTRLQPWLNVLPQQLTDWQ-NAEHGDFPRWLKALNKIPEGAPDQIDIKHS-VTISNDTPFHQGELKK-LESLL 83  Vibrio vulnificus YJ016
Q9KSU3   7 VYQQIAQhPQLQLWLNTLPQQLTDWQ-AKQHGDLDRWMRNLKKIPVGQPEVIDLKNA-VAAHNHQPLAQGEQKK-LEAVL 83  Vibrio cholerae O1 bi...
Q7N556   7 FYQLIAK-NNLQHWLNCLPAQLQEWQkAALHGNFKSWVKTLENLPEISPTQLDLKNG-VIAERDPPLSAGEKIC-LTNIL 83  Photorhabdus luminesc...
Q6D482   7 FYQQIAK-GPLSHWLNTLPSQLSSWQqESLHGKFKLWFNSLEHLPSLKPTSLDLNDS-VTARIEPDISVGQREG-IEKLL 83  Pectobacterium atrose...
Q6LT56   7 FYKLIAQhETLRPWLNTLPKQLSDWE-EAEHGDMGRWIRALKKFPTDKPDIIDIKNE-VSVRYEDGIANGEQKR-LESLL 83  Photobacterium profun...
P44167   7 FYQQIAT-TNLSDWLETLPCQLKEWE-TQTHGDYAKWSKIVDFLPNLHADEIDLKSA-VKSDRTSPLSEGEKQR-IIHHL 82  Haemophilus influenza...
Q7VL50   7 FYQQIAT-SHLSAWLETLPLQLKQWE-KTAHSDYAKWAKIATSMPT-SPTSINLTDK-VEAVLAEALPEGEKQY-LIYRL 81  Haemophilus ducreyi 3...
Q6AIL0   3 YLKHLSD-AADREAIKALHDERQTWV-NQEKKGFLRYREPYLQLARFKADSINLENDvVTIGHGEQISHEEQAE-IRQAL 79  Desulfotalea psychrop...
4P7C_B  10 LVRRLAG-TPLAEWANGLQAQLDTKX-SKGHGDLQRWQSALDALPALQPEKVDLTDS-FTLETE---CDGETRTvLRKAL 83  [Pseudomonas syringae...
Q8EEE6   7 FYQQIAD-SNLQHWLETLPAILGKWQrEHKHGNLPKWEKVLNKLHYPSPDSVDLVDS-VTIGTGEQLTPGEKEK-LENLL 83  Shewanella oneidensis...
4QNX_B  84 RNLMPWRKGPFSLYGVNIDTEWRSDWKWDRVLPHLSDLTGRTILDVGCGSGYHMWRMIGAGAHLAVGIDPTQLFLCQFEA 163 Escherichia coli K-12
Q7MJ71  84 RTFHPWRKGPYTVHGIHIDTEWRSDWKWDRVLPHISPLKNRSVLDVGCGNGYHMWRMLGEGARLCVGIDPSHLFLIQFEA 163 Vibrio vulnificus YJ016
Q9KSU3  84 KTFHPWRKGPYHLHGIHIDTEWRSDWKWDRLLPHISPLKNRLVLDVGCGNGYHMWRMLGEGAQQVFGIDPSELFLIQFEA 163 Vibrio cholerae O1 bi...
Q7N556  84 RIFMPWRKGPFSLYGINIDTEWRSDWKWDRVLPHISPLTGRTILDVGCGSGYHLWRMVGEGAELAVGIDPTQLFLCQFEA 163 Photorhabdus luminesc...
Q6D482  84 RNLMPWRKGPFSLYGVDINTEWRSDWKWQRVLPHISPLKNRLILDVGCGSGYHLWRMVGEGATMAVGIDPMQLFLCQFEA 163 Pectobacterium atrose...
Q6LT56  84 RLLHPWRKGPYNMHGIHIDTEWRSDWKWDRVLPHISPLQGRSVLDVGCGNGYHMWRMLGEGAALTVGIDPSNLFLIQFEA 163 Photobacterium profun...
P44167  83 KQLMPWRKGPYHLFGIHVDCEWRSDFKWDRVLPHLSPLQGRTILDVGCGSGYHMWRMVGEGAKMVVGIDPTELFLCQFEA 162 Haemophilus influenza...
Q7VL50  82 KQLMPWRKGPYHLHGVHIDTEWRSDFKWQRVLPHLAPLKDRTILDVGCGNGYHMWRMVGEDAQMVVGIDPTELFLCQFEA 161 Haemophilus ducreyi 3...
Q6AIL0  80 RAYMPWRKGPFAVFGVDIDAEWRSERKWQRLEKHLPDLKGKVIADIGCNNGYYMFRMAAQEPAFVLGIEPSVQHYYCFKA 159 Desulfotalea psychrop...
4P7C_B  84 LGLSPWRKGPFNVFGVHIDTEWRSDWKWSRVSPHL-DLKGKRVLDVGCGNGYYQWRXLGAGADSVIGVDPNWLFFCQFQA 162 [Pseudomonas syringae...
Q8EEE6  84 RLFMPWRKGPFHIHGIHIDTEWRSDWKWDRVKPHISPLQNRTVLDVGCGSGYHMWRMLGAGAKRVVGIDPSPLFLCQFEA 163 Shewanella oneidensis...
4QNX_B 164 VRKLLGNDQRAHLLPLGIEQLPA-LKAFDTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPGDR 242 Escherichia coli K-12
Q7MJ71 164 IRKLMGGDQRAHLLPLGIEQLPK-LEAFDTVFSMGVLYHRRSPLDHLIQLKDQLVSGGELILETLVIEGDETAVLVPKER 242 Vibrio vulnificus YJ016
Q9KSU3 164 VRKLLGDDQRVHLLPLGIEQMPE-LNAFDTVFSMGVLYHRRSPLDHLLQLKNQLVAGGELILETLVVEGDEHTVLVPFDR 242 Vibrio cholerae O1 bi...
Q7N556 164 VRKLLGNDQRAHLLPLGIEQLPA-LAAFDTVFSMGVLYHRRSPLDHLWQLKNQLISDGELILESLVVEGDEHTCLIPGER 242 Photorhabdus luminesc...
Q6D482 164 VRKLLGDDQRAHVLPLGIEQLPE-LAAFDTVFSMGVLYHRRSPLDHLWQLKNQLVAGGELVLETLVIEGDENQVLVPGER 242 Pectobacterium atrose...
Q6LT56 164 IRRLMGDDNRAFLLPLGIEQLPE-LKAFDTVFSMGVLYHRRSPLDHIIQLKNQLRKDGEVILETLVIEGDENAVLVPTGR 242 Photobacterium profun...
P44167 163 VRKLLNNDRRANLIPLGIEQMQP-LAAFDTVFSMGVLYHRKSPLDHLSQLKNQLVKGGELVLETLVVDGDINTVLVPADR 241 Haemophilus influenza...
Q7VL50 162 VRQLLGNDRRANLIPLGLEQMQP-LAAFDTVFSMGVLYHRKSPLDHLSQLKAQLVKGGELVLETLIIDGDINDILTPADR 240 Haemophilus ducreyi 3...
Q6AIL0 160 LEEMSGLTNLEIDL-LGVEHLPLfTESFDVVFLMGIIYHRSAPIETLRAVLDSLKPGGTLILETQGIPGEQPYALFPDKT 238 Desulfotalea psychrop...
4P7C_B 163 XQRYL-PDLPAWHLPFALEDLPAnLEGFDTVFSXGVLYHRKSPIDHLLALKDCLVKGGELVXETLVIPGDVHQVLVPEDR 241 [Pseudomonas syringae...
Q8EEE6 164 VKRLSGENHPVHLLPLGIEELPP-LDAFDTVFSMGVLYHRRSPIDHLLQLRDQLRMGGELVLETLVIDGDENAVLVPQDR 242 Shewanella oneidensis...
4QNX_B 243 YAQMRNVYFIPSALALKNWLKKCGFVDIRIADVSVTTTEEQRRTEWMVTESLADFLDPHDPGKTVEGYPAPKRAVLIARK 322 Escherichia coli K-12
Q7MJ71 243 YAQMRNVYFFPSARALKVWLELVGFEDVRIVDENVTSVDEQRTTNWMTHNSLPDYLDQNDPSKTVEGYPAPRRAILVAKK 322 Vibrio vulnificus YJ016
Q9KSU3 243 YAQMRNVYFFPSALALKVWLEKTGFVDVRIVDENITSLGEQRTTEWMTHNSLPDYVDPQDPSKTIEGYPAPRRAILIAKK 322 Vibrio cholerae O1 bi...
Q7N556 243 YAQMRNVYFIPSAKMVKIWLEKCGFVDVKIVDQAVTATEEQRRTDWMKTESLSDFLDPTDSNKTIEGYPAPLRAILIARK 322 Photorhabdus luminesc...
Q6D482 243 YAQMRNVYFIPSAVALTTWLEKCGFVDVRIVDICTTTTQEQRRTDWMITESLAEFLDPEDPTKTVEGYPAPVRAVLVARK 322 Pectobacterium atrose...
Q6LT56 243 YAQMHNVYFFPSAKALKVWMEKCGFVDVRIVDESVTTTDEQRSTDWMTNNSLPEYLSPDDPTKTIEGYPAPKRAILVARN 322 Photobacterium profun...
P44167 242 YAKMKNVYFIPSVATLINWLEKVGFTNVRCVDVATTTLEEQRKTDWLENESLIDFLDPNDHSKTIEGYQAPKRAVILANK 321 Haemophilus influenza...
Q7VL50 241 YAKMKNVYFIPSVAALINWLKKIGFKNARCVDQSVTTLAEQRKTEWLENESLVDFLDPTDQRKTIEGLPAPKRAVILANA 320 Haemophilus ducreyi 3...
Q6AIL0 239 YAKVPGTYFVPSASCLINWMHKAGFIDVDLFCDHPMSPEEQRQTEWMEFESYKDFLDPENPELTLEGYPAPHRFFVKATK 318 Desulfotalea psychrop...
4P7C_B 242 YAQXRNVWFLPSVPALELWXRRAGFTDVRCVDVSHTTVEEQRSTEWXRFQSLGDYLDPNDHSKTVEGLPAPXRAVIVGRK 321 [Pseudomonas syringae...
Q8EEE6 243 YGKMNNVWFIPSVAALMLWLKKCDFTDIRCVDTDVTALAEQRRTDWMPNESLVEYLDPKDITKTVEGYPAPKRATIIAVK 322 Shewanella oneidensis...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap