Conserved Protein Domain Family
Swi3

?
pfam07962: Swi3 
Replication Fork Protection Component Swi3
Replication fork pausing is required to initiate a recombination events. More specifically, Swi1 is required for recombination near the mat1 locus. Swi3 has been found to co-purify with Swi1 Swi3, together with Swi1, define a fork protection complex that coordinates leading- and lagging-strand synthesis and stabilizes stalled replication forks. The Swi1-Swi3 complex is required for accurate replication, fork protection and replication checkpoint signalling.
Statistics
?
PSSM-Id: 336879
View PSSM: pfam07962
Aligned: 125 rows
Threshold Bit Score: 69.8297
Threshold Setting Gi: 224005292
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121994911   69 RLTVDTLRGP-R-GIHTIENYF--KDVKL-KG-K-GHEKSDL--------------------------------DEVLRR 109
gi 124454162   18 RLKPEQITDP-QkGVVYLYNLC--KDYRF----G-NDELDEL--------------------------------NKYMHV 57
gi 74854137   238 KDKD--LLSF-K-GVSKLYNSL--KLSGF-STkQ-SNK-ANL--------------------------------EKLFGI 276
gi 74792111    54 ALNEKTLTGP-K-GITALREAF--QNFNP-NP-K-DDPYKNL--------------------------------EKMMKK 94
gi 195997503   50 KLDSDRLTSE-R-GLRALHQQF--NKLHF-KK-K-KDYHNNL--------------------------------ITILRI 90
gi 514699449  130 sLDVERLLNPeN-GVPYMLKTFs-KHVRF-SN-KpGMETRNL--------------------------------RLLMDH 173
gi 313233314   53 nLNEIRVTGK-Q-GLVKYLSYF--QNMNLsKE-K-NSEYANL--------------------------------QILMSR 94
gi 330800753  215 tikdrdvLAT-N-GIRKLYKNL--KSSKF-SA-K-HSNKTNL--------------------------------ELFFGI 255
gi 224005292   76 vLEPAQLKGP-K-GLIFVRRSFptQVSKF-RA-P-SNNSTNAatnkvigsgarsnkyaqklnqnaqikaaaqysRSLMSA 150
gi 1009343567  55 KLRDIELCGP-N-GFFELKRSF--DSFTP-KN-K--NPYDDL--------------------------------LVMMSR 94
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 121994911  110 LQHWGHRMYPTYTFDDVLNNIERLGKKKPLQVHMSRYRLGQL 151
gi 124454162   58 IEEWHYQIMPKYDFDYFTNRLQKFGGNNSVQTHLQFLRKAHK 99
gi 74854137   277 YSKWTKELNPYVTLENSIINVERLGRNRIVRNHIDDLKNGIV 318
gi 74792111    95 YAYWGHLMFPKMKTEDVLNRVETLGTRRQVKLYIMKQRLGES 136
gi 195997503   91 YEHWAHRLYPKLPFVDVVHKVENLGSKKAVQYALSLIRLGQn 132
gi 514699449  174 YDAWMDQLMPKMSLSNVVDTIERLGHKAAVRTYLTDLRLsqa 215
gi 313233314   95 LERWCHDLYPKFKLDATLQKIESMGSKSLVRNTIKRIRLNEL 136
gi 330800753  256 YSKWSKEINPAISIEDSIVKIEVLGKSKLVKNHIEDIKHGVY 297
gi 224005292  151 YRSFAQELFPTLAPQDVFLKIEDLGAKREVKDYLQIMRDELR 192
gi 1009343567  95 IEHWSHLLCPKMTFEDFVSRVESLSDKRMVKTMLTKMRLDMP 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap